CAZyme Information: MGYG000004677_01227

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-81
• CAZyme ID: MGYG000004677_01227
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		85521.08	8.1968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004677	2645140	MAG	China	Asia

• Gene Location: Start: 10321; End: 12558 Strand: +

Full Sequence      

MKKKKIWFWLMTVTSVIYILWRLLFTLPLDAGIVAFTAGIALFAAEFISMLGAVIHYICM
SKDRLPEFPAIEKEDYPHVDVFIATHSEESELLFKTINGCRHMEYPDPSKVHIYLCDDMD
RPEMARLAGDMKVGYLGLSGNKLAKAGNLNHALSRTSSPLVVTFDADMIPRSRFLMETVP
YFFLPEMICEDGVWRKRTEEEKDPDYKIGFVQTPQSFYNPDLFQFNFFAENNIPNEQDYF
FKEVNVGRNSSNSAIYAGSNTVISRQALEEVGGIRTGTITEDFATGIDIQSKGYTCFAVD
KVLTSGLAPTDFPTLLKQRQRWGRGCVQTIRSFRFLFGGMPFLSKLSYLSCLLYWWTFLR
RIVYILSPILFTVFGVLVVKTDIRGIALIWLPSYLIYNHSLRLLSGKVRDQKWSNIVDTI
LCPYMLFPILAETFGIRMKKFHVTNKEKTISKSAKLIYAIPHMILLAASLVGIYFSIEHM
LLYRNVLGIVVLFWLCMNTYFLAMAVFFLTGRINYRSSERFRAEIPVRCFVGEHEVHGVT
CDISENGLSFTTDFPEFIYGVTAYRLQDGAWSAEVKGTVVHVAPAGDRWRYSVRLEPLSM
EDRADYDQIVFDRVPALATEIRTHALKDLQVFFRRKTARSVSSKRRLPRIRLDRVLETEN
GAGVRVLDYNYQYMALAGDIPSPELCVKLGELRLRLKKVQSENGGRKTLFEAEDWQTVSR
SEELRRELQRLLQEEQTDEGTLQSA

Enzyme Prediction     

No EC number prediction in MGYG000004677_01227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	207	373	1.1e-23	0.8274111675126904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	7.89e-85	77	330	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.29e-57	10	548	188	716	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	1.24e-45	10	494	1	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	4.08e-28	86	331	7	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13632	Glyco_trans_2_3	9.45e-22	207	359	27	183	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08945.1	5.89e-261	3	725	10	734
ADL34255.1	1.13e-216	2	676	6	691
QLG36835.1	1.75e-200	13	724	17	718
QOX64858.1	8.24e-199	12	680	16	690
AEF82376.1	5.26e-198	13	684	36	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.48e-53	18	555	68	610	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.27e-53	18	555	80	622	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.30e-53	18	555	81	623	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.07e-49	18	618	213	797	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	5.97e-60	13	618	94	683	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q59167	7.19e-50	15	549	84	606	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
Q8Z291	9.72e-50	18	618	213	797	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
P19449	1.71e-49	10	567	81	636	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
Q93IN2	1.77e-49	18	618	213	797	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
33	55
335	357
362	379
386	403
413	435
456	478
488	510