CAZyme Information: MGYG000004650_00555

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004650_00555
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000004650_17|CGC1	59938.54	9.6653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004650	2976949	MAG	China	Asia

• Gene Location: Start: 16763; End: 18319 Strand: +

Full Sequence      

MKLAKYLLLFLCFVPLLLFRDFTPNNELKYLSIADEALRDGHFFAFWNHGAPYADKPPLY
LWIVMLGKWLFGTHNMFFLGLFSLIPAFITIHIMDKWVTPFLNGRYRNSIILMMITSGLF
VGSAIVLRMDMLMCMFIVLALYTFYKCYTEKENKYDPILLPIYIFLAVFTKGPVGILVPI
ISIPVFLWWQGKIRTFGHYLGWKQWGILLGLCFIWFGCVYIEGGKPYLNNLLFNQTVNRA
VDAFHHKAPFWYYLKTIWYSLAPWILLYLTAIITGIRKKLLNSDIKRFFLVIITTTFVAL
SIFSGKLDIYMLPIFPFIGYLAALMLPSLSERWLRIMVAIPATILALAFPGYFIALYTIE
FPFTPTILHPLSTFVLTTGSICALYFLYRKQLLPAINSMAIGLLITVFVGSFTIPALNPM
IGFKAITTKAEALAHERNIEKYHYFPFRSAENMDAYLGQSVHPLNINEIRERIGKENFIL
FVRDKERKRNPELHDLTGNTESYLIGGYWIFVFSSNPK

Enzyme Prediction     

No EC number prediction in MGYG000004650_00555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	439	6.1e-64	0.8185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.28e-21	7	414	15	428	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.06e-12	1	405	2	424	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	6.22e-05	55	201	1	146	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO50573.1	7.17e-173	1	510	1	509
QUU03965.1	5.50e-150	4	512	3	516
QLK84536.1	1.56e-149	4	512	3	516
QTO25703.1	2.21e-149	4	512	3	516
QKH86812.1	3.13e-149	4	512	3	516

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.46e-15	26	400	29	384	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q8D339	6.50e-13	19	315	34	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Wigglesworthia glossinidia brevipalpis OX=36870 GN=arnT PE=3 SV=1
C5BDQ8	6.06e-12	26	323	31	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B7NNT6	1.06e-11	26	323	31	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=arnT PE=3 SV=1
A7ZP75	1.06e-11	26	323	31	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.963395	0.036090	0.000269	0.000067	0.000065	0.000124

TMHMM  Annotations     

start	end
7	24
69	91
104	126
158	189
202	224
257	276
288	305
309	327
334	356
366	388
395	417