CAZyme Information: MGYG000004644_00994

Basic Information

• Species: Negativibacillus sp900547455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Negativibacillus; Negativibacillus sp900547455
• CAZyme ID: MGYG000004644_00994
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	MGYG000004644_49|CGC1	51299.79	6.9118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004644	2240162	MAG	Germany	Europe

• Gene Location: Start: 2151; End: 3476 Strand: -

Full Sequence      

MPNPFSYNILVTLDRNYLPVLRVMLHSLSQSDLEGEFTVYAVHNSLTEQDLQRLHTLFPR
VHPVSVKVPEGMLAGAPVSDRYPTEMYYRLFAAHYLPQQLDRILYLDPDLVVLNSLRKLY
EIDFGDNLFAAASHIESRAFRDLNRLRLNLPEQTSYINSGVMMMNLKLLRNESTQEIIDY
INEHKNALLLPDQDVLNALYAGRIIELDPMIYNLGDKYFYFKNVKLPREERFDLEWVRRN
TVVVHYYGRNKPWKENYLGVLGVFYQHFSRQLTEMVQKLPPEPIPMRRKERRVSDIGKIR
DILSACDCCRLGLSDDGRVYIVPLSFGFTERDGRFTFYFHSAKEGRKIRLLTQNGCAAFE
LDCSYQLKEGPTACSHSALYQSVTGFGRVTFLTQPEEKKQALLAIMRQNTGREDWEIPEA
ALDNLCTFRLDADEISCKEHR

Enzyme Prediction     

No EC number prediction in MGYG000004644_00994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	8	256	6.4e-52	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.19e-70	7	254	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.96e-37	8	256	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	2.69e-34	8	254	4	245	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
COG3467	NimA	6.25e-31	284	440	1	161	Nitroimidazol reductase NimA or a related FMN-containing flavoprotein, pyridoxamine 5'-phosphate oxidase superfamily [Defense mechanisms].
PRK15171	PRK15171	3.11e-16	86	255	107	272	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC85976.1	5.77e-86	8	298	2	294
CDX04293.1	5.47e-85	8	272	2	269
BAE85862.1	6.09e-85	6	272	14	283
AFL99655.1	7.74e-85	8	277	2	274
ACL19350.1	7.74e-85	8	272	2	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	1.45e-54	3	268	2	267	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
2FG9_A	1.10e-14	293	438	25	168	CrystalStructure Of A Putative 5-nitroimidazole Antibiotic Resistance Protein (bt_3078) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.20 A Resolution [Bacteroides thetaiotaomicron VPI-5482]
1SS9_A	6.26e-14	74	253	70	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.20e-12	74	253	70	252	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVV_A	2.11e-10	91	269	88	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	8.98e-18	14	256	14	258	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P19817	4.27e-17	77	253	97	270	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	1.58e-15	8	253	29	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URH7	1.14e-11	82	255	372	528	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P19816	2.61e-11	6	253	27	272	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004644_00994.