CAZyme Information: MGYG000004639_01671

Basic Information

• Species: CAG-495 sp000432275
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp000432275
• CAZyme ID: MGYG000004639_01671
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	MGYG000004639_8|CGC2	31990.8	8.8435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004639	1878053	MAG	Germany	Europe

• Gene Location: Start: 24098; End: 24907 Strand: -

Full Sequence      

MIPKKIHYCWFGEKEPGELEQKCIESWKKILPDYELRFWGNDCLDRFDNKYLRQAVEAKK
WAFVSDYVRLYALLEEGGLYFDTDEEVVRRLDEFMEHDFFIGSQRCGTAKEISPALIGAV
PHSEIIKNMLEVYDYTEFVNPDGSYNMTPNPKYFRKVLLEKYGIKNTYVKKGRVQICENA
FIYPYTYFCTSNKDAYAIHHYSGCWRPAWRVREKFSFRLGNNLFSFRKYKFKVKHGADEP
MPLKDGEKIVFSFRTSKQSQFMLIKKQVA

Enzyme Prediction     

No EC number prediction in MGYG000004639_01671.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	6.9e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.54e-12	1	97	81	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.88e-12	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.57e-05	1	100	45	150	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	9.32e-05	18	84	125	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.002	4	39	1	35	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC06113.1	1.96e-67	2	265	3	262
AJA44712.1	2.23e-66	2	267	4	265
QIM65043.1	1.23e-63	2	267	4	267
VEJ13839.1	4.91e-63	2	267	4	265
QIM63303.1	2.60e-60	2	267	4	267

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004639_01671.