CAZyme Information: MGYG000004637_00521

Basic Information

• Species: Duodenibacillus sp900542805
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus sp900542805
• CAZyme ID: MGYG000004637_00521
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	MGYG000004637_25|CGC1	78836.77	10.1533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004637	1523029	MAG	Germany	Europe

• Gene Location: Start: 10853; End: 12982 Strand: -

Full Sequence      

MFGRFVHLTLVSLFASVALVPTISARMLDETPARLEALAVRAAEAETDAQVEIESQETEQ
EGVPSRLLGTTTHQALIADSAFLSARNAYKNNDKKTLDELSQQVKGYPLSGYVELWQLLL
RAKNTPNNSDILSDMRRFIAAHEGEYLGERARGEAARIAALTGDIATFNAFWTKLTWQKT
EPDLRCFRALMMLKKHPTNEALNAAKKELATTPIIQDTSCKRLADETLARSPKWAWSYLL
ILLQRNRISVATDFLSSPFAKTILQAKDIAPVISKPKVWYTKNKKRLSRIPATRLAVEAL
CLAATDTDAAAQVASVAAKRLGPMTRTLVWGRIGYLAALNHDPKALSYYARAGSTLKDNP
LLINKDAVLAWHVRAGLHVSDWHEALKGIESMPASLQTQPAWRYWKARALSATGKKTAAK
KLYQSLAKHNSFYGLLACDALHLAYPAGQKIYNPPLPEKKKAAFAADASLQRALRFYDLN
LYYEGNREWSWAMRTMDKTERLALAEYALGIGLTHRAINTSATTGALVRSHLYPRAHADQ
VRQAAQLSGLPESWLFGLIRQESRFIAGAKSSVGALGLMQVMPRTARWVAKKIALENYRD
GQLTRLDTNLMIGSQYLKLIYDNFEGSVPLSCASYNAGPSRAILWRSRLTKPVDGALFAE
TIPFTETREYVKHVATNTTQYMYGTADQKRLTQILGIITPTPLSESKLP

Enzyme Prediction     

No EC number prediction in MGYG000004637_00521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	554	684	7.9e-21	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	8.88e-59	532	681	1	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK11619	PRK11619	1.22e-45	373	674	319	617	lytic murein transglycosylase; Provisional
cd16896	LT_Slt70-like	2.73e-39	534	674	1	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.58e-32	400	681	1	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	3.01e-29	552	677	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22242.1	4.97e-139	78	709	160	794
QQS89613.1	1.49e-128	79	709	162	803
QDA54820.1	1.89e-125	79	709	150	790
BCB28303.1	7.95e-107	67	699	11	631
AEV25092.1	2.21e-100	78	700	35	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	6.04e-57	326	698	207	577	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	7.73e-57	326	698	203	573	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	9.30e-57	326	698	213	583	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.00e-56	326	698	217	587	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.11e-56	326	698	223	593	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.15e-37	373	691	319	635	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.15e-37	373	691	319	635	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.15e-35	373	691	319	635	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	9.60e-22	377	674	273	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	3.03e-13	541	674	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002873	0.996265	0.000251	0.000214	0.000184	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004637_00521.