CAZyme Information: MGYG000004636_00492

Basic Information

• Species: Paramuribaculum sp009775605
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp009775605
• CAZyme ID: MGYG000004636_00492
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000004636_11|CGC1	70618.01	6.2098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004636	2253564	MAG	Germany	Europe

• Gene Location: Start: 21986; End: 23899 Strand: -

Full Sequence      

MNRINNLLVICAMALPLMVNAQKATVGLSADGGKLNYKVSYNGKTPVPSSPLGINVDNIC
LGTDIASFSKNPGAETSYTVKRKDGSSFYVDVREFDDGVALRYRIPADGPKCIYSEQTAV
TFPEGTRVWYASGPFQYGWLQEYQDRDISKIDNELLAPPATFRLPDGTYAAVTEANLRNF
HGAVLFGNNDNSVNFGYVENKGHVESGTITGMPGSHIHDVVRDYPWIAYPDEKTGEIVTP
WRVIMLASDLDGLVNNTIIGKVADAPDPELFPKGKDTEWIKPGRSVFTWLTEGNNRLSVA
NHKRYVDGAAELGLQSVVVDDGWELWPQTEPEGSAHTKWEYLKDLTDYAAQRGVDIWVWR
PSSVRAGNKTDIGLVDAGERRQFMKKCAETGVKGLKIDFFHTENLFTVNLMEEILKEAAR
NKLMVIFHGVNKPTGDNFTYPNLLAKEAVRGLECVGGENSWAPGPAWTYHNTVLPFTRWL
AGPADYTPLNFRAFCPKEISFAHQLATIYTFTSPMLILAADMEDMLSTPGRQFIEEVPVT
WDETRVLPESKIGEMAAIARRSGDVWYLSVLNGGKQYAGNLSTDFLPKGQYRTTIASEKD
NNPRQIAVTSGKTKSGRPLKVNLIPGGGYLVKFERVK

Enzyme Prediction     

No EC number prediction in MGYG000004636_00492.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	72	633	1.5e-129	0.8510301109350238

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.97e-60	276	538	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	5.55e-37	23	264	7	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.54e-23	541	633	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02726.1	0.0	14	636	14	639
QCQ49590.1	0.0	12	635	11	637
QRM72238.1	0.0	12	635	11	637
QTO25646.1	0.0	12	635	11	637
QCQ33866.1	0.0	12	635	11	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.01e-48	32	634	18	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.07e-47	32	634	32	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5XFM_A	4.35e-47	37	630	40	639	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3WFA_A	3.51e-38	239	637	266	707	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	3.53e-38	239	637	275	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	4.19e-53	16	629	40	616	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	3.85e-48	8	634	7	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.04e-37	239	637	286	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999191	0.000163	0.000158	0.000149	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004636_00492.