CAZyme Information: MGYG000004632_00818

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_00818
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		46968.47	9.4476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 40972; End: 42249 Strand: -

Full Sequence      

MNKSILRFAFMLLVSFLFIVGTKAQTAGAAISKANLPTPVTVFEDPYQGIPVRIPAMTIT
RDGGVIAMVDYRHNFSDIGWNSGGTYRLDILMRRSDDGGRTWSPINTVVEGRKDFGYGDP
SVVADRDSAGLILMQAVSGNVPYVHATAKNPQHAMFFRSTDGGKTWDKGHDVAPSIYNLY
RDEQPLTQEKGFFLTSGKITQSRIIKKDKYYRLYIAHPVLHVGTFVIYSDDFGKTWQVLG
GAATIPGPDGDESKVEELPDGSVLLSCRKFSSLGRRFNVFVYKNKKRAEGAWSEAKDAKA
LANCTRCNGDVVVVPVRRTIDGRKTWLAIQSLLQSKTRDHLGFYYREIPRRGADLAPALA
DNWQRGVMIHEGTAAYSTMSVFDDGTVGILYEADLDANNTGYKILFSRLSVSQITGGAYE
AMPAK

Enzyme Prediction     

No EC number prediction in MGYG000004632_00818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	52	409	3.3e-50	0.935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.08e-60	40	410	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.80e-06	75	282	67	242	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	7.37e-06	89	277	17	187	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	5.31e-05	51	236	274	484	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	0.007	156	237	3	58	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB40161.1	8.85e-112	42	423	36	429
QUI92932.1	2.52e-111	42	424	38	432
AXV50298.1	7.12e-111	42	424	38	432
QUB70796.1	1.38e-110	42	424	39	433
QUB91990.1	2.01e-110	42	424	38	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	3.55e-23	48	392	20	344	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	1.63e-22	48	392	20	344	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	5.22e-22	48	392	16	340	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
1W8N_A	5.22e-22	48	392	16	340	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
2BZD_A	9.39e-22	48	392	16	340	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	9.23e-23	14	392	16	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	2.61e-10	53	395	204	529	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
A6BMK7	1.08e-08	53	268	78	280	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2
Q5RAF4	3.36e-08	53	268	78	280	Sialidase-1 OS=Pongo abelii OX=9601 GN=NEU1 PE=2 SV=1
Q99519	3.36e-08	53	268	78	280	Sialidase-1 OS=Homo sapiens OX=9606 GN=NEU1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000368	0.998841	0.000275	0.000173	0.000167	0.000149

TMHMM  Annotations     

start	end
5	22