CAZyme Information: MGYG000004627_02134

Basic Information

• Species: Prevotella nigrescens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella nigrescens
• CAZyme ID: MGYG000004627_02134
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000004627_22|CGC1	41711.76	5.3158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004627	2663266	MAG	Germany	Europe

• Gene Location: Start: 25797; End: 26918 Strand: +

Full Sequence      

MIEEKKIFAIIILLMSVCIAFAQQQIVKDNHGRTMQINIPDAPEIMAETGAGYAGTKSYV
KENDVNAAAVPMEMEEETVAVGRLINRISGSLCLSYNPEVQKHIDKYVRQGRRSTSCLLA
RASYYNPIFEEALLYYGLPLELKYLPVIESGLNPKAVSGKGAAGLWQLMPATGRQYNLQI
NTFVDERLDPIKSSYAAARLLADLYKRFGDWSLVLAAYNCGPTRVSNAIEKTGNNTDFWQ
IYELLPKETRGYVPAFIAANYVMNCYAEYNILPEPTGLPERAGRVVVTEDVSLTKIANVL
NMDVADLRALNPQYRQDIVKTTEGAATLLLPSEKVKCFTDNVSQLYESSKNTEEQQLEMT
ARIEKETMHNPHS

Enzyme Prediction     

No EC number prediction in MGYG000004627_02134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	135	258	1e-25	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.82e-71	133	261	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	6.57e-42	138	340	117	320	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	6.39e-34	128	234	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.43e-23	149	261	11	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	2.36e-23	149	272	22	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB52701.1	3.23e-270	1	373	1	373
QUB54525.1	3.23e-270	1	373	1	373
QUB49588.1	1.32e-269	1	373	1	373
ATV40924.1	2.68e-207	1	373	1	373
ATV26571.1	2.68e-207	1	373	1	373

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.63e-30	97	311	74	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.63e-30	97	311	74	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	4.04e-17	137	237	37	138	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	6.67e-08	149	225	85	156	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.24e-07	149	261	1447	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011319	0.962739	0.025093	0.000281	0.000259	0.000268

TMHMM  Annotations     

start	end
7	26