CAZyme Information: MGYG000004625_01479

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004625_01479
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	MGYG000004625_15|CGC2	30106.03	4.6702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004625	2157144	MAG	France	Europe

• Gene Location: Start: 46352; End: 47185 Strand: -

Full Sequence      

MLGLERIEDLRDLGLEYLRLDYGFSAQRVAELSGVFRIVVNASTVSSDEIASWREAGADV
TRFAACHNFYPKPYTGLALEDIARVNLRLAALGFEIMAFVPGDANVRGPVFEGLPTVEAQ
RGRASKVALNMLELAHGADCDIVLVGDPDLSDAGWAQFAQVSAGYVDLQCELEPGYAYVR
GQIHHDRPDSSVLIFRSQESRTTLKPDSVSTDAGAGLPRKAGSIAVSNSGYGRYEGELEI
ARVDLPGDERMNVAGHITPEAMELLPFIKRGFGVRFV

Enzyme Prediction     

No EC number prediction in MGYG000004625_01479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	8	276	3.5e-80	0.7685714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	4.05e-54	7	160	81	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	3.95e-53	4	277	81	357	Uncharacterized protein [Function unknown].
pfam05913	DUF871	8.36e-27	166	277	5	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
PRK00969	PRK00969	4.21e-04	167	271	191	307	methanogenesis marker 3 protein.
COG4070	COG4070	5.37e-04	155	271	179	306	Uncharacterized protein, methanogenesis marker protein 3, UPF0288 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33651.1	5.43e-197	1	277	74	350
ATP53905.1	4.96e-193	1	277	74	350
AZH69275.1	1.00e-192	1	277	74	350
QOY60728.1	9.96e-118	2	277	75	351
QHQ63310.1	1.82e-94	2	277	75	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0O_A	1.54e-45	5	271	83	352	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]
1X7F_A	2.28e-18	12	268	114	375	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	1.98e-23	8	269	75	336	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004625_01479.