CAZyme Information: MGYG000004605_00659

Basic Information

• Species: UBA7173 sp900555165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900555165
• CAZyme ID: MGYG000004605_00659
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000004605_7|CGC1	84438.73	5.1738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004605	2767428	MAG	France	Europe

• Gene Location: Start: 3036; End: 5348 Strand: +

Full Sequence      

MNKLALLTVISALAGAGAAAAASSPSEVIVATDAYRWQGDTIFQGEYKAWAVSPDEIQST
YSARPHYFMPVERTWKRKNDLSAYPRLTTGNRLHQAIYNMGLDEMVNAVEPDTTLRTGKE
WSGVWTRDVSYSIILSMAYMQPEASMISLMKKVNPSGQIIQDTGSGGAWPISTDRIIWVV
AAYEIYKVTGDRSWLEKVYPIAVRAIEKNDLTVMSDAGLMKGETSFLDWREQSYPRWMQT
VDISQSEAMGTNMAYVATLRATADMARILGKKKEAERFTAQADALAQAVHARFWMPDKGY
YGMYTYGRDNLVMNPRAETLGESLAIIYDIAPADAVKSISENNPNTPFGAAIFYPQIADM
PNYHNNTLWPFVGSYWAIAQAKAGNEAGTMEAIGAIFRPAALFATNKENFNLDNGDIFTE
LNSSNMLWSLSGNIALTTRILFGIHFEPDGLVISPFVPKALEGTRTLDNFNYRGATLNIT
VNGYGANVRSISLNGKALKPGELIAASKLKGVCDITVDMDNQPIPPMKLNRVPNLKAPLT
PDARLTASADYAGQGVPVLNLLEWNPIEYIGQYIVLKDGKEVGRTRRTSWPATVPGEWQV
IGVAADGTQGFASEPRSNRESFAVDFPAEVTEPVSAEISYRPATPVTGYMGNGFVETDRT
SAPPTLEIDVPAAGRYSIVWRYANGNGPVNTENKAAVRTLVIDGKKAGTVVMPHRGVANW
DDWGMTNTVKADLTAGRHTVALEYLPEDENMNIATNHALVDRVVVTLLPE

Enzyme Prediction     

No EC number prediction in MGYG000004605_00659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM35	645	747	1.9e-16	0.773109243697479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	1.03e-19	647	748	21	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	6.67e-13	121	385	281	553	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17389	Bac_rhamnosid6H	1.18e-12	165	302	78	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04082	CBM35_pectate_lyase-like	2.02e-08	647	743	20	109	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
TIGR01577	oligosac_amyl	6.07e-08	105	301	276	465	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	3.22e-203	72	770	212	895
AKQ46615.1	1.09e-197	74	766	227	903
AYA38918.1	3.57e-195	73	768	234	915
QTE38578.1	3.17e-193	54	766	204	887
QEC42842.1	5.20e-193	65	770	207	897

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000841	0.998123	0.000313	0.000295	0.000222	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004605_00659.