CAZyme Information: MGYG000004603_00576

Basic Information

• Species: Streptococcus oralis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis
• CAZyme ID: MGYG000004603_00576
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22876.03	8.9088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004603	1819449	MAG	France	Europe

• Gene Location: Start: 284924; End: 285526 Strand: +

Full Sequence      

MFKFIRRVLVLAVFLFAGYKAYHIHQDVKQVMTYQPMVREILSERDTPANEELVLAMIYT
ETKGKERDVMQSSESASGATNTIKDDASSIRQGVQTLTDNLYLAQSKGVDVWTAVQAYNF
GPAYIDFIAQNGKENTLALAKRYSRETVAPILGNTTGKTYTYINPISIFHGAELYENGGN
YYYSRQVRFNLYIMKFFNFF

Enzyme Prediction     

No EC number prediction in MGYG000004603_00576.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	9.82e-84	28	191	1	165	Lysozyme-like.
cd16891	CwlT-like	2.32e-65	34	187	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	1.12e-07	1	198	93	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHZ47760.1	1.30e-137	1	200	1	200
ANR75830.1	1.85e-137	1	200	1	200
ATF56771.1	2.63e-137	1	200	1	200
QXW60630.1	1.07e-136	1	200	1	200
CBZ00708.1	1.07e-136	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	2.69e-18	30	187	23	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	3.55e-16	30	187	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	5.04e-121	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	1.02e-120	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
P0DC90	5.72e-70	15	195	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	5.72e-70	15	195	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	8.12e-70	15	195	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.819219	0.116473	0.062312	0.000479	0.000286	0.001231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004603_00576.