CAZyme Information: MGYG000004596_01172

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000004596_01172
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000004596_47|CGC1	46072.23	7.5955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004596	2214446	MAG	France	Europe

• Gene Location: Start: 2141; End: 3373 Strand: +

Full Sequence      

MNVKNVLRGVVACAGIAACVQFTPAPEARAARPDWTDKAVENARKQIGLEIDTIEASGKC
LNPVTLTPGGKVVYCGYADWRSGFFPGSVWYLYELTGDESLRPLAEKYTEALDKAKTLTW
HHDIGFIINCSYGNGLRLARKEAYKDVMVQAAKSLCTRFHEKPGVIQSWNVTGNSWQAKR
GWECPVIIDNMMNLELLFEATKLSGDSTFYKVAVAHADRTLKEHFRPDGSCYHVIDYSKA
DGCVRHRQTAQGYADESAWSRGQAWAIYGFTMCYRETGDRKYLNQALKTFRFMKNHKNLP
KDLVPYWDMDASKIPNEPRDASSAAVIASALYEISTYDVPDAASYKDYADRILQSLASPA
YTAPLGENGRFVLMHSVGSIPHNSEIDVPLNYADYYYLEAIKRKKDIEKN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	78	403	7.3e-124	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.19e-06	79	308	28	234	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT78393.1	5.79e-236	1	409	1	404
QRP56362.1	5.79e-236	1	409	1	404
QUU06876.1	2.35e-235	1	409	1	404
ASM67776.1	1.15e-234	35	409	16	390
QKH85475.1	3.54e-229	1	409	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.22e-108	34	409	30	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.99e-49	37	403	29	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.04e-49	37	403	30	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	2.85e-49	37	403	30	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.09e-48	37	403	30	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	5.50e-109	79	407	76	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	1.12e-48	37	403	30	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	4.70e-46	38	403	32	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	4.17e-45	71	403	33	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	4.88e-42	38	403	29	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000753	0.709460	0.288559	0.000586	0.000340	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004596_01172.