CAZyme Information: MGYG000004588_00684

Basic Information

• Species: Prevotella sp900317685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900317685
• CAZyme ID: MGYG000004588_00684
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1518		163425.17	5.7009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004588	3452051	MAG	France	Europe

• Gene Location: Start: 20837; End: 25393 Strand: +

Full Sequence      

MRKKYILAGLLAMFLTTGTHAQRVTDKLDRGLVAVKTSGGVFCSWRVNAEEYYDVTYNLY
RDGVKVNDKPLTVSNFTDPAGSTSSTYTIRPIIKGVEQSTSSKAASVLAHDYLEIAKPKR
LSNDGKTDVTDVYEPNDATIADVDGDGEMELIVKEICTTDDPKNKPDGPDFDRIEVFKLN
GQLLWWIDCGPNLCDFQHNETNIAAYDWDGDGKAECIMRAADGTILHTASGKTIVIGDKS
KNYRADCQNGSMSEFFVHSGAEYLLYLNGQTGEPYQIGPAEHPDYMDYPLKRLEDGETDL
AKAWGDGYGHRSSKNFFGAPYIDGHKPSIFLARGIYTRHKMIALDVDPATHQLSTRWRWN
CNTPGSPWYGQGYHNYSIADVDWDGRDEICFGSMVIDDNGKGLSTTGLGHGDAQHVGNFD
PYRHGQEIFACNEDAPANNYRDATTSKIYYRLAGGGDDGRSMMGNFTDKVPGAIGASGHD
TPISAVTAKHIDNTSKDFDLNFRIYWDGDLLEETLNGTQVRNSTFRIHKFGKGDIKTLDG
SLSNNDTKATPCFQGDIFGDWREEVVARTPDNKIRIYTTTDPTEYRNCTLLSDKQYRNAM
VWQMNGYNQPPHVSYFLGKMEGITVAPPPETTNGRTVVDNGGSIGAGLNDKQVMLDETND
MTVSVSDGAAPYIFFDNAPTWVQGHDDNNNITTTVYTHTLTGGAFSGAMRLIKQGDGTLV
LPKVDERYTGNTDVWAGTLAFDGTLKSSRLWLNRFANLHSDGGTFASIKADYGAAIRPGG
QDKVGTITTDSLALGFGSIVDFDIDANGNADQIVVNKVMSIETKDWTQGPEYLAPRFNFH
FIDGKVKAGSYTLGKVQKVDGDIAKVVVTGLKGHKATIAVNDGNLVLTIADSRQAADVEW
NGAQGTTWNIADTENFTNTKEKTSDVFVSGDNVTFNDNAASGTVVIKGEVSPASVTFNNS
KLEYDLSGDAITGNTKIIKKGTALAKLHNVSDFTGSVSIENGTLAVDHLGQKSGVNNGAL
GVYTNKVSLNGGALEALANLTTDHPVMLGSKGGTILVDEGKTLTLNTSITGSGNTLTKTG
KGTLTLAPSANYGTLNVMEGWVNSQEQDNVHGYPKNIVLNNGTTLSDADNMYSYSSNGVN
VKVPEGATASWYLDSRCNYTGQLTGAGTLNLYSRNTRAYLKGYWGDFTGRLNIAGKKTGS
YTPMLYVQGSLKNAEVNATITLNNNGSNVAVGSMSGSAQLDGKGIWSIGGNNKDFTFQGY
VNGGGLVKIGNGMMTIGKKQDKLSKQVDVQGGTLNINSSATAITADNRWFGQQTVSVTNG
GCFAGRGVVEKILVNDGGTLQPGNAANSIQYGALKTASGCYLYKGAKVLFNIYSTKLYPS
LGTDGTLSLADGSTVAVALNSKYAPKTGDTFTLWDVNTLSASADGVTLQLPALPNGLAWD
TTELFQQKGLLKVVTATGINQLTADAVFHCEVFKTNGTRVGALTTTKARLNEDIRGLHVE
PGLYLVKAGATTMKVIVK

Enzyme Prediction     

No EC number prediction in MGYG000004588_00684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	25	620	8.1e-162	0.9759862778730704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	4.03e-171	26	615	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	4.14e-35	23	107	1	85	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
PRK15319	PRK15319	1.35e-04	867	1324	647	1073	fibronectin-binding autotransporter adhesin ShdA.
pfam12951	PATR	0.004	711	739	1	28	Passenger-associated-transport-repeat. This Autotransporter-associated beta strand repeat model represents a core 32-residue region of a class of bacterial protein repeat found in one to 30 copies per protein. Most proteins with a copy of this repeat have domains associated with membrane autotransporters (pfam03797). The repeats occur with a periodicity of 60 to 100 residues. A pattern of sequence conservation is that every second residue is well-conserved across most of the domain. These repeats as likely to have a beta-helical structure. This repeat plays a role in the efficient transport of autotransporter virulence factors to the bacterial surface during growth and infection. The repeat is always associated with the passenger domain of the autotransporter. For these reasons it has been coined the Passenger-associated Transport Repeat (PATR). The mechanism by which the PATR motif promotes transport is uncertain but it is likely that the conserved glycines (see HMM Logo) are required for flexibility of folding and that this folding drives secretion. Autotransporters that contain PATR(s) associate with distinct virulence traits such as subtilisin (S8) type protease domains and polymorphic outer-membrane protein repeats, whilst SPATE (S6) type protease and lipase-like autotransporters do not tend to contain PATR motifs.
NF033176	auto_AIDA-I	0.005	896	1347	79	513	autotransporter adhesin AIDA-I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM09959.1	0.0	13	1507	2	1527
AGB29439.1	0.0	1	1516	1	1517
BCS86257.1	8.21e-313	24	910	1	890
ABN51485.1	9.33e-130	23	629	257	814
QYR22020.1	1.65e-129	19	633	48	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	1.54e-126	21	629	1	578	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	8.12e-122	19	629	4	585	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	7.05e-117	22	629	5	599	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.08e-126	2	629	11	615	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	3.06e-116	22	629	5	599	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
A0A0H3GGE2	3.84e-06	971	1071	2027	2118	Adhesin BmaC autotransporter OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=bmaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.998969	0.000219	0.000171	0.000155	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004588_00684.