CAZyme Information: MGYG000004587_01448

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_01448
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		38665.43	4.4387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 101; End: 1102 Strand: -

Full Sequence      

MAETLSNKYANLKTQNIYQYLRAIYGKRVLAGQCTDYGNNTETDALYKGLGKYPAVRTFD
FIFDSPNMGFKNDRPAKDYDLAIEWSKDGGLVVYDWHWHSPCNGNDFNTDKTSFRLSNAV
TDKDLAHMSLKEIKKLYKSGEITEEAYKLVSDIDYISSLMQKLEDNNVTVLWRPLHEASG
GWFWWGGSGAEAYKWLWKLMYERMTDYFELDNLIWVWNAQSGEWYPGDEYVDIAAIDIYN
AAHDYGASPAMLSDMHGWTDGVKMVTMSECATMPDPDLIVRDNAYWLWFAVWNWDFIVKN
GTPELSDAFTDYYMMEKVYNSEVIITRDELPKF

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	7	329	3.7e-90	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.78e-36	7	329	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	3.32e-09	115	239	128	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30045.1	2.03e-120	4	333	185	510
BCJ93286.1	3.31e-119	4	333	186	511
ABX41451.1	6.01e-117	4	333	185	510
ANW98509.1	2.93e-86	3	331	182	501
AGC68130.1	2.93e-86	3	331	182	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.13e-58	5	330	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.58e-58	50	330	48	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.03e-49	15	331	44	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.72e-46	10	333	50	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	3.67e-44	5	330	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.26e-61	4	330	173	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	1.14e-55	4	333	155	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P49425	1.31e-55	5	331	146	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	1.12e-54	4	333	156	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55297	1.70e-54	4	333	157	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004587_01448.