CAZyme Information: MGYG000004587_01027

Basic Information

• Species: UBA1409 sp900553675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900553675
• CAZyme ID: MGYG000004587_01027
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000004587_8|CGC1	35210.62	4.68

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004587	2560840	MAG	France	Europe

• Gene Location: Start: 37695; End: 38603 Strand: +

Full Sequence      

MLLRRRTPNRRISANEVTKEVYQYLCDSFGEVMLSCQQESTWMGSPDYEMDIIEKATGKL
PAMRGLDFMNGDFDGVVERSKQWWEKGGLVTICWHTGINGKGYQESKDDIPDFDKLLDES
TPEHAAMIENWDKAAKALSELRDAGVPVLWRPFHEFDGGWFWWGKGGGENFIKLWRMMHD
RFTNEFGLDNMIWVLGYSGEVKDGWYPGDEYCDIIGSDTYDNSTHKSAYDKLDKMKTGKP
IAFHECGYVPRIERFEDDGCLWSWFMIWHTDFISRHDKMDLHAVYNSDKVITLDELPEWG
KQ

Enzyme Prediction     

No EC number prediction in MGYG000004587_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	14	295	2e-88	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	7.41e-34	7	295	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.53e-13	144	249	178	298	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	3.18e-106	13	298	171	461
BCN30282.1	4.60e-106	10	301	4	301
AWB26443.1	5.86e-82	14	302	53	342
AJP70762.1	1.45e-71	5	296	15	318
AAK19890.1	2.49e-68	13	297	210	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	4.79e-50	13	296	27	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	2.95e-48	13	299	149	450	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	6.88e-48	19	299	44	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	7.64e-46	14	275	50	321	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	3.58e-43	14	296	11	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	2.25e-50	8	299	142	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	4.62e-49	13	299	178	479	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.05e-41	14	300	33	354	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	1.88e-40	19	300	168	465	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	2.55e-40	19	300	166	463	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004587_01027.