CAZyme Information: MGYG000004569_01008

Basic Information

• Species: RF16 sp900556095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900556095
• CAZyme ID: MGYG000004569_01008
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	MGYG000004569_11|CGC1	26183.6	6.0723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004569	2389314	MAG	France	Europe

• Gene Location: Start: 7940; End: 8629 Strand: -

Full Sequence      

MPAGYEQSRGKYPVLYLLHGSGGDEQAWIELGRTTQILDNLIAQGKAEPMIVVMPNGNMS
EDAAPGCGVKGLVQPNIPDAHRMDGFFEECFPEIVRFVDARYRTMRKANERAIAGLSMGG
YHSYWISLNYPHMFGYVGLFSAVYHYGDDMPQAVYQNETEKLAKLRNNKPLYRIYIGNED
FLYTQNVEQRQLLDSLQFPYAYTESAGGHQWTNWRHYLADFVTCLFHSL

Enzyme Prediction     

No EC number prediction in MGYG000004569_01008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	1	222	7.6e-50	0.9074889867841409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	4.68e-36	2	226	89	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.81e-24	10	220	22	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.99e-12	11	223	53	306	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	8.23e-11	4	179	31	201	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG3509	LpqC	1.02e-04	2	142	54	177	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW58566.1	3.59e-82	2	226	172	397
ALJ59664.1	8.80e-82	2	226	167	392
SCD19884.1	9.70e-81	2	226	164	389
BBE20341.1	1.12e-80	2	226	171	396
AKJ87218.1	2.12e-80	2	226	167	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.70e-57	2	226	153	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.51e-31	2	226	160	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	1.73e-27	2	226	163	381	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
1JJF_A	8.33e-24	1	222	52	254	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.26e-23	1	222	52	254	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.60e-25	2	226	452	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	6.74e-22	1	222	71	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	4.04e-20	2	226	164	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	4.53e-18	1	226	520	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	3.05e-12	1	228	847	1077	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004569_01008.