CAZyme Information: MGYG000004559_00544

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000004559_00544
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000004559_14|CGC1	42848.56	9.1175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004559	2216405	MAG	France	Europe

• Gene Location: Start: 13992; End: 15140 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGANLMHGLLAHDPSCEIRFWGGDRMAAQGGTLVRDYRDNAVMGIV
EVLGRLGSILRNLRFCKQDILSWKPDAVILIDYPGFNLKIARFAHRHGFKVFYYIPPKVW
ARGERRIRLLKEYVDRTFIIFPFEVPYFKSRGLDVIYNGNPLTDNIDSTPSVHLSRSAFL
SSHSLADDGREIIALLAGSRKMEVDYLLPRLVKAVTIITRKTGRRFRFLLAAAPSISPEY
YRKYLDGNTEIEIICGDTYGVLSHAAAAAVSSGTASLEAAIIGTPQVVCYGMNPVTYAIA
RMVVRLDTISLANMILGKHIFRELLQGECTPGNIAAELLRMTDDRAYRGRMISDYAEMRE
KLGEKDSATRTAADMERIIKEQ

Enzyme Prediction     

No EC number prediction in MGYG000004559_00544.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	363	5.1e-112	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.48e-100	1	372	2	368	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.87e-98	1	375	2	374	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.04e-75	4	339	2	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.86e-75	5	376	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.23e-38	1	382	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	2.01e-123	1	364	1	355
ADY50863.1	1.05e-113	1	372	1	359
QKJ32584.1	3.10e-113	1	372	1	360
AYL97782.1	2.58e-112	1	372	1	360
QEM12843.1	3.15e-111	1	372	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.97e-42	5	362	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.72e-42	5	362	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	4.15e-76	5	380	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	4.76e-75	2	372	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.66e-74	2	372	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	8.92e-72	2	363	8	364	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	1.20e-68	2	372	6	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004559_00544.