CAZyme Information: MGYG000004518_00546

Basic Information

• Species: Zag111 sp002103105
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp002103105
• CAZyme ID: MGYG000004518_00546
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	MGYG000004518_1|CGC2	52656.98	9.472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004518	1841689	MAG	Israel	Asia

• Gene Location: Start: 548957; End: 550324 Strand: -

Full Sequence      

MKERILLFVIVLGLTAFIYIFQSYTEWGLALLVILMSIYAIFTTIAYKIKQRIDLKKPQI
KDNSYKPFVSIMIPAHNEETVIAHTIETVLKLDYPNFEIIAIDDRSTDNTASVIKDIERQ
YPEKVKAFIRPKDAFPGKSAVLNDALEIAKGEAILVFDADATMEQDFLTNLVYELEPKDV
GAVQARKIVRNKDMNILTRCQNNEMTMDTYFQVSRDAVKGAVELRGNGELIKRAAIEDIG
GWNNYTITDDLDMSTRLHIKGWDVRFCPNTAVYEEGIMYLFPLYRQRRRWLEGTIRRYLE
YFWDILTSKKMSLRARLDTIAYISEFIMPAWFIIEIGILLVKVFVKDAPPHILLSSVIMG
GIIGLGFVMACRYSLRRYDNLPRKAALIQSIETSIYLLLIWFPLVLFIGFKILFMKKDMN
WGKTAHGLIQHEHAIQKAKEKIRQAKEELKKLLKK

Enzyme Prediction     

No EC number prediction in MGYG000004518_00546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	67	291	3.7e-37	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	3.99e-55	18	426	9	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.70e-51	71	250	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.62e-47	34	417	19	405	N-glycosyltransferase; Provisional
cd06437	CESA_CaSu_A2	8.16e-37	67	293	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	7.24e-33	52	296	14	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	1.05e-202	45	434	3	391
AGY58232.1	3.15e-70	30	426	37	415
BAZ42219.1	7.06e-70	67	426	108	465
ASC69718.1	8.51e-70	22	426	47	448
QEQ01403.1	9.25e-70	64	426	99	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	4.06e-12	67	295	128	376	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.27e-12	67	295	140	388	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.27e-12	67	295	141	389	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.69e-10	58	295	264	502	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
3BCV_A	6.38e-08	67	166	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8YMK0	1.78e-66	67	426	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	3.51e-66	67	426	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	3.28e-60	67	427	108	467	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	7.28e-29	58	294	39	280	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q5HKQ0	2.04e-27	34	313	12	290	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
319	341
351	373
393	415