CAZyme Information: MGYG000004513_02415

Basic Information

• Species: Victivallis sp900550905
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900550905
• CAZyme ID: MGYG000004513_02415
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1117		125147.62	9.3423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004513	4294613	MAG	Israel	Asia

• Gene Location: Start: 8930; End: 12283 Strand: -

Full Sequence      

MKSSFFLLPVLVLLCGNAAGVDYDCFQNRNTPPRLHEAAKRTQTLNFSDSGNWSVTVPPG
GHPLAELLFPKPLLPPEGKTLVAELEFTAKNPAAIANLLLRVVDAGGETHSIPAVRTGSR
AEWLLAPGMPTPNSWGRGVNRKLDFPFKVSGIAVNFRGKEGGEIQLGRFAVSDPARRILI
PSAKTLRKFTPYNARRLDGTPVRQEMTLAGLRLQFPAAGRCRINEWGILAEESLEQLQAI
LLQGKLLRGNARIRVRCLKPENRKWVESAFLPFPPQGETLRLPLPEAGKLQFREIEIDAE
AGTELLLERMLAEQPRLHPEALEVEVKTGRPARLLLLTPESAKSFALRFTNRSARPLELA
GVFRFRDLYGSERIFRREIRLDAGEAEEWKPFELSSRNQIWKLEYLLTAPDKTRASGSLF
FGLLTPSGTDKPANPGFRFGVCNHWINPDAVEAMRFCGIRSVRCTTPWFEFQPGPERWNF
LPLDEKLDSLEGTGIRLRSTLAYTPPWAALPPAKSRQESRNRLPRLDAWRTYVETLVKRY
RGRIEFYEVWNEPDLRGFADFPAEKFVELQRAAFEIIKAVSPELVVASGGFATVRPEHEG
GRTLKFHQKTLELAGKSFDLHSYHEHGPFDNYPYLLDHVFLPMRRKYGITQPWIASETAI
HSANGNEVPQAETLFKKLIFSWSRGAVGYTWYNLINSGENPGYGEHNFGMLTRRLEPKFV
YGVYNMITGTYREAAYLRQFDSEEPYQFLFRTPQELLLAGWNRTGEEGSSLFFLESDASG
AERIDLLGNRTPAAHSGGGTVYEIGRFGATLALKGATKTGSPRLIAELLLPPNRIPGRAA
PASLRLTNPWRGARHFRLLPESAVRRLPEEVTLKGGETRELPLVLADSPAAELVAAVKIA
GDGWPEPLRVSGVIRQARLIPAGEIDGNREPDFQLERYSDLVTPWENDPATAHLIWRDAR
DLSAQIRLGSDGTDFLLRVDVEDDLHAPTRTPERLWNGDSVQFALAFSGQSGYFELGAAE
NGDNPHSGVWQVPAGFSTAAVRRAMRTEVRRSGTRTIYQFRIPWQAFGADAKLREPGVRF
NLIVNDNDGDRRKGWLQIAPGLGTNQTMAHSPVLIFQ

Enzyme Prediction     

No EC number prediction in MGYG000004513_02415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	474	732	6.6e-25	0.6682134570765661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.92e-46	931	1116	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	1.14e-15	954	1095	10	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	2.19e-11	925	1102	4	176	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam01229	Glyco_hydro_39	3.34e-08	478	617	74	234	Glycosyl hydrolases family 39.
smart00633	Glyco_10	3.06e-05	468	553	3	86	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	9.42e-166	52	1117	217	1307
AVM46276.1	3.70e-159	65	1117	57	1137
AVM44759.1	2.39e-141	247	1116	84	964
AHF94342.1	1.14e-116	391	1116	283	1032
AVM45104.1	6.06e-104	295	1103	305	1121

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999160	0.000150	0.000161	0.000138	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004513_02415.