CAZyme Information: MGYG000004499_02811

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_02811
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1005		110333.75	8.1566

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 16198; End: 19215 Strand: +

Full Sequence      

MHKLLLPLFLSFLLPALSAAELLQFGDAEFQLEGRKIPGLDQVKIEPAPLSGSRRNGTAV
RWGNPAPAAMELGLVSPASPEIGRFEQATLSLQVEFPEPVELRRIVLRLRDSSGELFQFV
NTASGTFSGKRQLDYRVAEGAAAAVWGGDRNRKIDWPLRFHGIAVDCSARTRPGAGILLD
SLSFRRFGEAVNLSLKTGHRFNLLLPQRQEPPALVVRNEGTGELVLGGVLRIEDGAGNLR
QAGVSARATPETPGRIVLPGDYSAPGWWKLNYRLISATGKEYSGEHRFGRMVPAGPVAKR
APGFLLGVCSHMERFGREKAELEALAAGLCGAGIMRLDFSWNRFQPEPDRWNFTLYDQLV
ALLAAQGVEVEAILGNPPDWAIPRDFTPKYRAPEFARVGRFADPALYAAFCAKIAEHYRG
RIRYFELWNEPDLILFANFDFPRYMELLRAGYDAIRRVSPQAVVMNGGIAGTQTDAGGDP
RSNNGWIKQLKEDGGKHFDLFAFHGHGPLAGYLTQLEQLERSGLIGENAPRPWYSNETAE
SSVRIGEREQAASLFKKLLTARAFGAVGYNWYNLREKGELYAPGHYERHFGLLTTEFEPK
PAYLAFNMLAATYRNAEFTGRIPAGKEISALRFRRADGGTLLALWNNQRERPRTLFATLP
PGTVKVDLFGKETPVELQGGNACIPVSSTPFTLKTPPGGNGEIRLARGFLPEQLPVHLIL
EPGRERTCPIALFNPAEKPLSLTLNAAAPDGVSVAPEREVVPLQPGETRAVTLHLRAAES
FTAPLSHPATLQLELSLGGAVVERVPLSLIRKPAAGEPLFVLADAGQYHALVPSAPGNEP
FYWKGPADLSARIFLERRGEFLRLRAEVTDDLPVQTNSGEAIWRGDSVQFGLALPGQKGF
WSIGFARRDDGGTEVFCWSRPEGFADPSSAVRVNARRDDGSRRTLYEALLPFAALGMTRE
IAGNGFRFNLIVNDNDGKLREGYLAAAPGMGTGEDPSLWKVLQLE

Enzyme Prediction     

No EC number prediction in MGYG000004499_02811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	350	652	2.8e-31	0.7331786542923434

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	5.58e-63	818	1004	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	4.70e-12	843	999	30	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	8.53e-10	843	983	12	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam02449	Glyco_hydro_42	1.37e-05	339	420	32	125	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam01229	Glyco_hydro_39	1.54e-05	395	611	112	349	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF90198.1	2.17e-165	84	996	81	997
AHF94342.1	5.56e-162	55	1002	80	1030
AVM44759.1	1.17e-125	266	990	233	950
AVM47149.1	1.79e-115	47	1005	203	1307
AVM46276.1	2.70e-111	168	996	303	1128

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.04e-17	306	690	106	493	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
1KWG_A	6.04e-06	305	384	1	83	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998926	0.000247	0.000143	0.000149	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_02811.