CAZyme Information: MGYG000004499_02673

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_02673
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731		82919.02	8.6743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 7254; End: 9449 Strand: +

Full Sequence      

MKKYLELLIPMFAAAGLCAAEFQLPQSLLNEPFPERFTSLQASWEKEPLDADFALSSPLA
GGFGVKSIPGFSGKGIEITEPGGQIHYRGESNLNPETAVIQFRVCGPAWREDESMTLFSA
LRESYSMDIVKRKNRLSLAVRNLLYMYPGDRSETDKPEDFRLISEVSIPLDAVSEGEWQT
VTAGWDLKKQEGFIALNGKGRSGKLAIPQTDKREFLLFLLGGAIRPENCPDGLSIPGMKF
DELKIASCRYADLLAWKSLPPPPDLLARTEKGVRKTLSTLAALQRMNAGWQNVYTYPGFL
GAEAQGRQLLQYDDIITNDKSRGSAYVAAQFAYAYELLQDYHALDIAKKTADFYVRAQSP
EGAWLYLYKVGPNRIECGSHKPEYKFQDSCQSHPLYLLAYMYRLTGTKQYLEAMKRCGEF
YLSAQNPDGSWSHHYDMEAKVGRTCRGLPQGGEINDLAMNDAIDVMILMYHLTKERKYID
AVKRAGEWLLKAQLKGAVSGWADQYDRNLKPIWARHFEPPALSWESTRHASQAMVTLYRL
SGDERYREALKNTAEWFQKKFPDGKCFAYYDISTGRPVLAHMDHVYLLDDAEQMAKYASF
RRGKKPVPDKTVPNFRALLAAMVYPVREPKLDKPALDRMRRITESLAKMATNSQNKDGLW
VYPVYASVINSVGAGFIPGQGRLMMQLRYIDVMRMMRGELPLHYRGGIYTHGEGNMRNFA
WPSGWYDIPWK

Enzyme Prediction     

No EC number prediction in MGYG000004499_02673.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	454	597	6.9e-32	0.5333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	4.29e-09	398	589	49	266	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
COG1331	YyaL	2.26e-05	398	549	420	559	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd00688	ISOPREN_C2_like	2.75e-05	264	506	97	282	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.
cd04434	LanC_like	1.99e-04	318	481	96	242	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
pfam09492	Pec_lyase	5.87e-04	425	493	1	76	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF93518.1	3.86e-253	13	731	12	753
QDT35456.1	5.05e-28	349	661	105	442
QDV11681.1	1.55e-26	327	661	100	458
QDV67619.1	8.95e-26	327	661	100	458
QDV55675.1	1.01e-25	327	661	83	441

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.055924	0.789151	0.153884	0.000377	0.000305	0.000343

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_02673.