CAZyme Information: MGYG000004499_00182

Basic Information

• Species: Victivallis sp900551245
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp900551245
• CAZyme ID: MGYG000004499_00182
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		94461.48	6.5845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004499	4071424	MAG	Israel	Asia

• Gene Location: Start: 206255; End: 208720 Strand: -

Full Sequence      

MENFIDLSGEWSLKSADWEHGRTIPAQLPGDNYSALLAAGAIPDPYFGCNETLVQEFRKY
EWEFEREFDVPTSLLEYDSVYLNVEQLDTFGTIFINGHRVLTGNNMFRRYRPEVKPALKP
GRNVIRIHFKSAELEAKKEALRQKREIPMNGCSKVEHLNLIRKVHCHGGWDWGITLMVTG
VYAPLTLTGVNLARIDYVHTEQKHEKKRVTVTAVAELSALRSGRKTVTFTFNGETKTVTA
SLKKDENRVKALFVVDNPKLWWPNGLGEASLYLLTVSTDDETVEQEIGLRTLEVVNQPDE
YGVSMYFRVNGFDVFCKGADWIPADAMPARVTPAVLDDLLESARLANMNMLRVWGGGQYE
SEEFYRLCDRKGLLIWQDMMFACSLYPSNEEFIENVRQELNFQIRRLRHHPCLALWCGDN
EVIGATRWYGEDKRLVNTIHYDRLNRELARMVETFDPDRLFWPSSPCGGPNNFNDGWHDD
SCGDMHYWEVWHGGREFSAYYSVKPRFCSEFGYQSFPSFETVKRFCPPEQFNVFSPVMDH
HQKCVRGNAPIIGMFGKYFRMPESFENFLYLSQVQQALAIKTGVEFWRSLKPRCMGTIFW
QLNDNWPVASWASIEYGGKWKQLQYHAKRFFAPVIGVLYQDEAKVLQLHLVSDLPVKAAA
TVTAVAYDFDGNELRRFDLSASLRPNENRRLKSFKASELADLDPDACFIELVTVAETAEG
RRFRHENTFFFSPFKRCDLRKAALQVQVEEKDGHYFCRLTTDKPAFFVTLDTPGIPGIFS
DNSVTLLPGVPVALEFTPKRKTSLKELQKTLAVNDLRNTYN

Enzyme Prediction     

No EC number prediction in MGYG000004499_00182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	649	2.7e-97	0.6343085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.02e-115	1	820	9	806	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.88e-20	741	818	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.79e-09	193	290	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	1.91e-07	646	735	3	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	3.60e-07	211	421	187	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44113.1	0.0	1	821	1	822
QDU34180.1	5.20e-277	3	820	9	835
QQE12237.1	5.25e-265	5	820	11	829
AYV24530.1	7.79e-245	5	820	4	804
ASI92427.1	8.86e-244	5	820	4	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	4.35e-153	8	820	5	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.60e-153	8	820	7	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.73e-153	8	820	7	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.25e-152	8	820	5	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	5.18e-151	8	820	5	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	5.96e-134	5	820	23	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	8.71e-128	5	820	23	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q4FZV0	7.76e-125	7	820	25	881	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	1.61e-122	7	820	25	879	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	1.21e-121	7	820	25	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004499_00182.