CAZyme Information: MGYG000004491_01979

Basic Information

• Species: Prevotella sp900548745
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548745
• CAZyme ID: MGYG000004491_01979
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000004491_91|CGC1	88924.96	4.9539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004491	3066074	MAG	Israel	Asia

• Gene Location: Start: 8663; End: 11158 Strand: -

Full Sequence      

MELNGTNVTIIIPGLTAGQTVTVSCMTGKNGVARGLNVTNLTPVAGSFNSTSTEKQTNVG
TVTADGDVQLSTSAGMYVYSIEVGEGGGTEPVNPSTGSNVAMNLNKNQMRVTLNTNDVKY
YNTESVSSVNINGGNITVNPANGNAADVYEGNVKNLAFAKAKDGGQSGDIDSPAGAVQIS
ESKGWLESVYAKWTPYSGAESYNVYCNDKKIDEQLIRLYPSFVRADVLGLAAGTYNLKVV
AVDKDGNEIAGSASTVSNLQVKNYSREGFAHFHSKSVGVGAYNNDGTLKKGAKVFYVTAK
TAKTISTEVKGAGTCTGIQAIIDGYQKGEDKTPIAFRFIGLVKKDNLDNVSSSSEGLQIK
GKSEYSEMNMTFEGVGDDATVHGFGFLCRYAKGVEFRNFAIMRCMDDCISLDTRNAEIWI
HNMDFFYGPNGGGDHAKGDGTVDLKDDSQYLTFSYNRFWDTGKSSLCGMKSETQPNYITY
HHNWFDHCDSRCPRVRTMSVHVWNNYFDYVAKYGVGSTTGSSVFVENNYFRGTNRPMMSS
QQGTDATGDGTFSGEKGGIIKSFGNVFAENSKYFSFITYQKNNTSFDAYEASSRDEQIPA
SVKALVGGTSYDNFDTNSSLMYSYAADAAEDVPAIVTGFYGAGRINHGDFTWTFEDIDGH
NSASYAYDAKLGSALDNYKTTLVKVYGEGGSSTETGSGSGSGETGGTETGGGSTETPEGT
VLCTFTGKTPSSSIFTVTGNYSTSKGTATIDGNIYDTCVKMESSTSIDFTLSESKKVTIY
FADTETASIKIDGTKKKGSESSYTETLAAGAHKLTKADSRNVFGIKLEPVE

Enzyme Prediction     

No EC number prediction in MGYG000004491_01979.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	364	532	4.9e-40	0.8267326732673267
CBM77	724	823	6.9e-24	0.9611650485436893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	1.83e-52	228	646	1	345	Pectate lyase [Carbohydrate transport and metabolism].
pfam18283	CBM77	1.76e-38	719	825	1	108	Carbohydrate binding module 77. This domain is the non-catalytic carbohydrate binding module 77 (CBM77) present in Ruminococcus flavefaciens. CBMs fulfil a critical targeting function in plant cell wall depolymerisation. In CBM77, a cluster of conserved basic residues (Lys1092, Lys1107 and Lys1162) confer calcium-independent recognition of homogalacturonan.
smart00656	Amb_all	9.69e-23	369	530	17	186	Amb_all domain.
pfam00544	Pec_lyase_C	3.99e-13	439	530	115	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67442.1	6.63e-299	100	830	31	776
QUT73893.1	3.32e-235	176	829	22	683
QCD40816.1	1.99e-215	109	686	1	588
QCP73706.1	1.99e-215	109	686	1	588
QOR20273.1	4.29e-194	177	678	50	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	6.58e-25	309	530	22	246	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
5FU5_A	5.76e-19	725	831	12	117	Thecomplexity of the Ruminococcus flavefaciens cellulosome reflects an expansion in glycan recognition [Ruminococcus flavefaciens]
1VBL_A	1.77e-16	365	530	129	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
3ZSC_A	5.48e-13	377	515	76	221	Catalyticfunction and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1AIR_A	6.15e-11	349	644	97	342	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65DC2	3.09e-22	314	539	64	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=BLi04129 PE=3 SV=1
Q8GCB2	3.09e-22	314	539	64	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis OX=1402 GN=pelA PE=1 SV=1
B1B6T1	3.09e-22	314	539	64	281	Pectate trisaccharide-lyase OS=Bacillus sp. OX=1409 GN=pel PE=1 SV=1
A1CYB8	6.61e-16	369	561	93	289	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1
Q4WIT0	3.89e-15	369	556	93	284	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999839	0.000177	0.000008	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004491_01979.