CAZyme Information: MGYG000004490_01619

Basic Information

• Species: Muribaculum sp003150235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp003150235
• CAZyme ID: MGYG000004490_01619
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1214		136896.28	5.0571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004490	3323418	MAG	Israel	Asia

• Gene Location: Start: 74646; End: 78290 Strand: -

Full Sequence      

MQKPINLYALSLLLLGASSQVTAANAPDSVFIYPGQRGASVSPTMYGVFFEEINHAGDGG
LYAELVQNRSFEELEMPEGYHAEGCWLYPRPVKNHIDSKIKPEKYRWTTEPVPGWKLAPG
DSLHGSMRLSKENPKFAAAPNNLEISVNGNKAPVTLINDGYWGMGLHEGENYKLRIIGRT
ERGYKGDITALLLAENGDTLASQPIKLKNDGKWNDITLTMTPDAATKKGKLALVFNRKGK
VWLDYVSLFPESTFNNRDNGLRKDVATMLADLNPAFVRWPGGCVVEGISLDNRFEWKKTL
GDPASRPGEYSTWGYRCSYGFGYHEMLQFCEDINAGAMFVCNVGLGCQYRMGDASPEDRI
DYYLQDCLDAIEYALGDTTTTWGSRRAAAGHPTPFPLKYVEIGNENWGDEYDRRFDIFYK
AIKEKYPELVLISNHGLQGTGKITVTDMIDPHFYVEPEFFYTNTRLFDNHPRGNYKVYVG
EYACNREVGGGNMNAALSEAAFIGGMERNGDLVTMASYAPLFENRHDRTWSTNLIWIDSD
DVMGRASYYVQQMAAENRPTCNVALDVKKSPADTTDVSPRQFIFSGYDDNTGEIIIKAVN
ATGDGYNVNFSLGDDYTIAKSGKVITLAAASLEDENSWDEPEKIIPVESRFDGFGQQFGY
TFKPFSYTILRVKALPKYFTNPVVFADIPDPDVIRVGDNFYMVSTTMHFSPGCQIMKSRD
LVNWQVIGSAYDRLEDTDAFSLKNGQNDYAKGSWAANLRYDPYEKLFYLIVSCNTTRKSY
IFTTPDIEHGPWHRNEVEMCYDPGLLFDDTGKECKKYIVYPDFDLNVHTAYYRPIISDGK
GNVTLGKRETLIDYTQIENPSEGLRAEGYHGYRIGDYYYIFMIQGQGWQRQETVWRAKEL
APGAFEPRKIFTGNIENPDGTAHLGSTGVAQGGIVDTPDGKWYAMLFQDYGAVGRIPVLV
PVTWNDGWPVLGNDGKSVDHTLPMPVATAERHFTVVSDEFDNGTPTYRYSDTPATLPEHT
DNGSWLKPEWQWNHNPDNRYWSLTERPGYLRLTSGHIATSIRDARNTLTQRTFGPISAAE
TVIETANMRDGDRAGISAFQNQYGYVGVKRENGKNHVIMHRASCKDDSKGIEIESIPIDC
DRIYLRTVCDFRDKTDKASFYYSLDGKEWKRIGDTLQMNFDWPDFVGQRFALFYFSTANT
GGSVDFDYFHVKEG

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	239	553	2.3e-85	0.5063492063492063
GH43	680	969	4.3e-81	0.996309963099631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09001	GH43_FsAxh1-like	7.47e-119	679	972	2	270	Glycosyl hydrolase family 43 such as Fibrobacter succinogenes subsp. succinogenes S85 arabinoxylan alpha-L-arabinofuranosidase. This glycosyl hydrolase family 43 (GH43) includes mostly enzymes that have been annotated as having beta-1,4-xylosidase (beta-D-xylosidase; xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. This subfamily includes the characterized Clostridium stercorarium F-9 beta-xylosidase Xyl43B. It also includes Humicola insolens AXHd3 (HiAXHd3), a GH43 arabinofuranosidase (EC 3.2.1.55) that hydrolyzes O3-linked arabinose of doubly substituted xylans, a feature of the polysaccharide that is recalcitrant to degradation. It possesses an additional C-terminal beta-sandwich domain such that the interface between the domains comprises a xylan binding cleft that houses the active site pocket. The HiAXHd3 active site is tuned to hydrolyze arabinofuranosyl or xylosyl linkages, and the topology of the distal regions of the substrate binding surface confers specificity. It also includes Fibrobacter succinogenes subsp. succinogenes S85 arabinoxylan alpha-L-arabinofuranosidase (Axh1;Fisuc_1769;FSU_2269), Paenibacillus sp. E18 alpha-L-arabinofuranosidase (Abf43A), Bifidobacterium adolescentis ATCC 15703 double substituted xylan alpha-1,3-L-specific arabinofuranosidase d3 (AXHd3;AXH-d3;BaAXH-d3;BAD_0301;E-AFAM2), and Chrysosporium lucknowense C1 arabinoxylan hydrolase / double substituted xylan alpha-1,3-L-arabinofuranosidase (Abn7;AXHd). A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG3507	XynB2	2.99e-66	673	1213	15	548	Beta-xylosidase [Carbohydrate transport and metabolism].
cd08989	GH43_XYL-like	5.77e-45	681	964	1	271	Glycosyl hydrolase family 43, beta-D-xylosidases and arabinofuranosidases. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes that have been annotated as having beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity, including Selenomonas ruminantium beta-D-xylosidase SXA. These are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. It also includes various GH43 family GH43 arabinofuranosidases (EC 3.2.1.55) including Humicola insolens alpha-L-arabinofuranosidase AXHd3, Bacteroides ovatus alpha-L-arabinofuranosidase (BoGH43, XynB), and the bifunctional Phanerochaete chrysosporium xylosidase/arabinofuranosidase (Xyl;PcXyl). GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18617	GH43_XynB-like	1.67e-42	681	970	1	284	Glycosyl hydrolase family 43, such as Bacteroides ovatus alpha-L-arabinofuranosidase (BoGH43, XynB). This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes that have been characterized to have alpha-L-arabinofuranosidase (EC 3.2.1.55) and beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activities. Beta-1,4-xylosidases are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Also included in this subfamily are Bacteroides ovatus alpha-L-arabinofuranosidases, BoGH43A and BoGH43B, both having a two-domain architecture, consisting of an N-terminal 5-bladed beta-propeller domain harboring the catalytic active site, and a C-terminal beta-sandwich domain. However, despite significant functional overlap between these two enzymes, BoGH43A and BoGH43B share just 41% sequence identity. The latter appears to be significantly less active on the same substrates, suggesting that these paralogs may play subtly different roles during the degradation of xyloglucans from different sources, or may function most optimally at different stages in the catabolism of xyloglucan oligosaccharides (XyGOs), for example before or after hydrolysis of certain side-chain moieties. It also includes Phanerochaete chrysosporium BKM-F-1767 Xyl, a bifunctional xylosidase/arabinofuranosidase. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam17851	GH43_C2	2.01e-40	997	1212	1	203	Beta xylosidase C-terminal Concanavalin A-like domain. This domain is found to the C-terminus of the pfam04616 domain. This domain adopts a concanavalin A-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60076.1	2.09e-299	28	673	26	837
QUT88785.1	1.10e-298	36	674	33	836
ALJ60214.1	1.25e-297	36	674	33	836
QJR66308.1	2.71e-288	28	674	27	824
QJR70571.1	2.71e-288	28	674	27	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MLY_A	9.60e-126	680	1213	22	512	ChainA, Bifunctional GH43-CE protein [Bacteroides eggerthii],6MLY_B Chain B, Bifunctional GH43-CE protein [Bacteroides eggerthii],6MLY_C Chain C, Bifunctional GH43-CE protein [Bacteroides eggerthii],6MLY_D Chain D, Bifunctional GH43-CE protein [Bacteroides eggerthii]
6ZPS_AAA	3.82e-78	40	672	12	624	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
3ZXL_A	1.08e-61	679	1204	8	524	Engineeringthe active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens],3ZXL_B Engineering the active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens]
3ZXK_A	1.99e-61	679	1204	8	524	Engineeringthe active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens],3ZXK_B Engineering the active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens]
3ZXJ_A	1.68e-60	679	1204	8	524	Engineeringthe active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens],3ZXJ_B Engineering the active site of a GH43 glycoside hydrolase generates a biotechnologically significant enzyme that displays both endo- xylanase and exo-arabinofuranosidase activity [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SG80	4.86e-97	38	649	52	632	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	8.38e-97	41	649	54	628	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
P82593	3.75e-87	9	557	11	539	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q8NK90	1.16e-72	36	670	33	625	Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfA PE=1 SV=2
Q96X54	2.15e-72	36	670	33	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori OX=105351 GN=abfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998980	0.000214	0.000172	0.000167	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004490_01619.