CAZyme Information: MGYG000004485_01401

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977
• CAZyme ID: MGYG000004485_01401
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000004485_15|CGC1	41867.87	9.7816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004485	1911658	MAG	Israel	Asia

• Gene Location: Start: 3739; End: 4890 Strand: -

Full Sequence      

MLTVYLVAGEPSGDLLASRLMRALKKKTGGAVRFYGVGGETMAQEGLTSLFDSSELAVMG
LMEVIPSIPRILKRISQTVQDIVDKKPDVVVTVDSWSFSARVNKALKARKTGIPQFHYVA
PQVWAWKKKRAKTCGRYIDELFALLPYEPPYFEPHGLKTDFVGHPVVEGGASKGDGAAFR
EEYGIAADAPLLCVLPGSRRSETKYLLPVFQETVSRLKRKYPALRVVVPTVVTVAEKVKK
AVASWDVPVTVVTGEKARYDAFAAANAALAASGTVALELAMARVPYCIAYKMNPISSFLA
PLVVKGKYVNLVNILADKLIVKEFLLKNCRADWLANEVDLLLSDETYRQTQISQASQVLN
LLGAGQAETPSDKVADILLAHRK

Enzyme Prediction     

No EC number prediction in MGYG000004485_01401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	361	3.3e-118	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.80e-129	1	381	1	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.18e-128	1	378	1	375	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.68e-98	4	371	1	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.89e-73	3	344	7	347	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.18e-46	1	325	1	300	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE51288.1	1.23e-133	4	379	3	378
ARJ65449.1	6.26e-130	2	379	6	383
CUW40282.1	8.88e-130	2	379	6	383
AUN29831.1	4.95e-127	4	379	6	381
AWU93490.1	5.52e-125	3	382	16	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.75e-56	2	344	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.45e-56	2	344	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	2.45e-134	4	379	3	378	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	4.82e-119	2	379	4	380	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	9.03e-87	4	375	31	398	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	1.66e-81	4	344	6	343	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	1.81e-81	4	379	13	386	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004485_01401.