CAZyme Information: MGYG000004461_02475

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000004461_02475
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		58937.95	5.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004461	4658877	MAG	Israel	Asia

• Gene Location: Start: 8305; End: 9852 Strand: -

Full Sequence      

MMKKEFNPRLEWKSEIPVPVCTEHPEFNELYRIAWDLAHDHMLDIPGMPQTPYMDEAFCD
TDIWIWDSCFMALFCKYAQSRFPGVETLKNFYKVLYDGGQLPEIVSRNAPAWTGVLPGQK
TRMVIHIMDNPPLFAWAEYQNALFSGDREHVADLLLKKRYLQKHFEALEALKTRTRIPGV
RSETCWIKHEKGYFWEGGRSGMDNTPRGRIGEHAEENRPNNPDMLWIDAISQQGLAAFCI
AALAELIGEKTLADEWNARYEAIRETVNRNYWDENDGCYYDIGSTHGEFMKILTPASFWP
LVSGMGTPAQAEALSRLLTDPRKLGGVVPLVSLARDDADFNRDDGRYWRGSVWVPTAYAA
IKGIERYGMYSLARELSGKILTHMYETFRQYEPHTIWECYHPERPEPARSCDENTRIVRS
NFCGWSALAPIGLYLENVIGIYSVNAFTDTVKWALPERFAGELGVRNFRFGETVADLIAF
EGSVFVTSNRPFTLIVNGRRFSIPAGSSRQTLSVE

Enzyme Prediction     

No EC number prediction in MGYG000004461_02475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	51	427	7.4e-21	0.3701754385964912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.92e-16	240	403	591	759	alpha-glucosidase; Provisional
PRK13270	treF	7.96e-15	240	401	362	512	alpha,alpha-trehalase TreF.
pfam01204	Trehalase	5.85e-13	240	404	318	477	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	7.25e-13	242	441	432	610	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	4.98e-12	200	428	234	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	9.50e-243	1	509	84	592
QZT38129.1	1.74e-162	17	512	33	502
QWP09187.1	4.73e-140	11	508	4	472
QWP15489.1	4.73e-140	11	508	4	472
QWP35628.1	4.73e-140	11	508	4	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.70e-11	240	383	564	715	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.70e-11	240	383	564	715	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.70e-11	240	383	564	715	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.84e-11	240	383	113	264	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.84e-11	240	383	113	264	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	7.20e-30	68	456	59	408	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	9.44e-11	240	383	587	738	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P53008	1.69e-10	180	440	570	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
C4ZW66	4.63e-08	240	401	362	512	Cytoplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treF PE=3 SV=1
P62601	4.63e-08	240	401	362	512	Cytoplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999740	0.000284	0.000008	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004461_02475.