CAZyme Information: MGYG000004459_00767

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA791
• CAZyme ID: MGYG000004459_00767
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		30869.65	6.7614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004459	1336458	MAG	Israel	Asia

• Gene Location: Start: 85331; End: 86095 Strand: +

Full Sequence      

MQIPKRIFYVWGHNEPKKQIVNICLENWRMMLPDYEIIEINEKSKEWFDFDYEYNNNLWF
KTIYDLKMWAYVADYMRVKTLYEHGGIYLDTDVTIYKDFEPLLKDNMFAGMMINNIPELA
IVGAQKNNPILKDMYDFYQNEIWHSKEFIIINILDKILKEKYGVIPNKEQIVKTEYISLY
PTEYFYPYHYGYEFKHEYITSNTYTSHWQNASWVKKSTLFFMTNKSRLPLPVLLKQYELF
KQVEAKTGDKVKLN

Enzyme Prediction     

No EC number prediction in MGYG000004459_00767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	105	6.5e-17	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.81e-19	3	150	82	227	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.38e-13	21	109	4	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBA50716.1	1.05e-59	3	219	2	216
AVQ31609.1	1.05e-59	3	219	2	216
VEH39584.1	1.05e-59	3	219	2	216
AVQ28665.1	2.09e-59	3	219	2	216
SQJ00557.1	2.09e-59	3	219	2	216

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.65e-06	3	131	57	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004459_00767.