CAZyme Information: MGYG000004457_01540

Basic Information

• Species: CAG-485 sp900767075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900767075
• CAZyme ID: MGYG000004457_01540
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000004457_180|CGC1	35596.02	7.297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004457	2747221	MAG	Israel	Asia

• Gene Location: Start: 405; End: 1364 Strand: -

Full Sequence      

MTRKIVAAFIAALSILLPLSSRSANYMRDITIAADGSGDFRTFGEALEAIRAFMDYKVTV
HIKNGVYNEKVIIPAWLENVDFIGESADGVIIRQNDYAGLNNMGTFRTYTVRVDGKNLNF
RNMTIENTAGRVGQAVALHTEGDNLSFENVKLKGNQDTLYTGGRGTFLNFKDCYIEGTTD
FIFGPSTAWFENCDLHSKMNSYVTAASTPADTEYGYIFKNCRLTADPGVDKVYLGRPWRP
YANTYFIDCEMGPHITAAGWHNWNNADNERTARYGESGSRGEGARGERVAWAKKLSKKEA
DAITPEKVFCRKSTWKPAE

Enzyme Prediction     

No EC number prediction in MGYG000004457_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	308	1.5e-96	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	5.75e-66	29	305	1	291	Pectinesterase.
PLN02773	PLN02773	1.47e-62	28	301	5	288	pectinesterase
COG4677	PemB	6.96e-61	15	299	74	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	1.18e-59	29	302	242	536	Probable pectinesterase/pectinesterase inhibitor
PLN02990	PLN02990	2.03e-55	29	317	260	561	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69178.1	7.94e-143	16	319	18	322
QQY38333.1	6.09e-141	13	319	5	316
ALK82867.1	6.09e-141	13	319	5	316
ABR39474.1	6.09e-141	13	319	5	316
QQY41711.1	8.64e-141	13	319	5	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.33e-36	29	305	8	298	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.85e-32	32	291	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.48e-30	30	279	11	264	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	1.83e-30	55	284	58	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	7.78e-30	30	279	11	264	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.99e-49	28	300	5	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	4.71e-46	29	317	259	560	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q9FM79	1.74e-44	23	299	75	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8GXA1	2.31e-44	32	317	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LXD9	6.82e-44	29	295	240	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.033615	0.950131	0.015217	0.000355	0.000315	0.000351

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004457_01540.