CAZyme Information: MGYG000004452_00211

Basic Information

• Species: CAG-793 sp000433915
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-793; CAG-793 sp000433915
• CAZyme ID: MGYG000004452_00211
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		20519.69	5.371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004452	1272541	MAG	Israel	Asia

• Gene Location: Start: 4708; End: 5253 Strand: +

Full Sequence      

MKKAIIVIIVAIIALIIILNSRNILKLIYKTNYSEYVEKYAQENDIDPLLIYAIIKAESN
FNELAESNRGACGLMQLMDSTAREVATNTAIEYETGNTLYNPEKNIALGVKYFADLKSQL
KYTQVALAAYNAGIGNVTKWIENGTIKADGSDIENIPFKETNIYVRKILKDYKIYQKLYE
E

Enzyme Prediction     

No EC number prediction in MGYG000004452_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	35	176	1.2e-27	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.06e-60	33	174	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.94e-55	29	178	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.08e-35	48	173	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.68e-27	37	177	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.23e-27	20	179	126	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK79074.1	7.09e-44	1	180	1	181
AEI33967.1	7.09e-44	1	180	1	181
AWV81671.1	7.09e-44	1	180	1	181
ADZ20149.1	7.09e-44	1	180	1	181
QOX62656.1	5.72e-43	21	180	22	181

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	7.06e-21	29	179	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.09e-21	29	179	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.12e-21	29	179	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.14e-21	29	179	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	7.17e-21	29	179	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	5.40e-21	29	172	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.40e-21	29	172	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	1.00e-17	33	169	428	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	3.44e-16	37	172	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	4.11e-16	33	169	480	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.719212	0.273665	0.005569	0.000350	0.000268	0.000942

TMHMM  Annotations     

start	end
4	21