CAZyme Information: MGYG000004444_00308

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000004444_00308
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		43319.9	10.1728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004444	1865391	MAG	Israel	Asia

• Gene Location: Start: 13981; End: 15138 Strand: -

Full Sequence      

MKKIYLIAGEPSGDLLGSRLMRAIKKKTNGDVAFYGVGGETMEEEGLKPLFDIADLSIMG
IMEVIPSIPKVLRHIKNTVEDIMRVQPDVVISIDSWSFSARVHKALRRKKTGIPQVHYVA
PQVWAWKKKRARTMYKYIDRLLTLLPYEPKYFTPYHLPTNFVGHPVIESEALHADGKKFR
EKFKVPADKRVISVLPGSRKTEVSKLLPVFFDAVRELSKQNDDLFFVIPTVKTVAETVKL
EAKKSGLPVVVTETQQDRYNAFKASSAAIAASGTVALELAILDVPHIVAYKVSAFSAMLA
RKFLKIQFVNLSNILLGREIVPELLQERCVPGNIRSYIKGLLQKDDLYDRQMAGFKKVRE
VLGLGEQTPSENVADIVLQLCEKKK

Enzyme Prediction     

No EC number prediction in MGYG000004444_00308.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	1.2e-120	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.72e-135	1	380	1	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	4.26e-135	1	385	1	379	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.23e-100	4	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.93e-77	4	380	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.04e-56	1	380	1	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	3.49e-186	3	384	6	387
ARJ65449.1	5.86e-113	4	385	8	390
CUW40282.1	1.08e-110	4	385	8	390
BAE51288.1	1.30e-110	4	385	3	385
QQP92097.1	1.05e-109	4	385	8	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.11e-56	4	382	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.17e-56	4	382	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
7TGH_T1	1.01e-07	2	341	16	426	ChainT1, Lipid-A-disaccharide synthase [Tetrahymena thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	2.60e-111	4	385	3	385	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.20e-109	4	384	6	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	6.77e-84	4	380	31	404	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q1QMM4	1.10e-83	2	379	11	387	Lipid-A-disaccharide synthase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=lpxB PE=3 SV=1
Q2IW93	5.63e-83	1	383	11	392	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004444_00308.