CAZyme Information: MGYG000004418_00470

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA9783
• CAZyme ID: MGYG000004418_00470
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000004418_2|CGC1	62589.96	8.989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004418	1047512	MAG	Israel	Asia

• Gene Location: Start: 49304; End: 50926 Strand: +

Full Sequence      

MRKSTCAVFSLLVFLFFGQIAFRPLANPDEGRYAEIAREILQSGDWLTPRLNGLLYFEKP
PFVYWCTALGERLFGTNVFGARFFNALFALLTCFCVYRFCTHFFNRTFGNIAAGILGTSL
LWCEMSQLITLDVTLSFFITASILSFAWGFLTPHAGDARKHFFLAYIFVAFAVLTKGFIG
LIAPALVGLPWLILTGHWRKLGQSYLIRGCLLIVLINFPWHYLMAVKYPEFCHFYFWHEH
FERYLLPDHNRMKPFYFLPLSFLFGMFPWALFFPRALCASAESWHSKWVREIVLLGTFWS
LGLVGFFSFSHSQLIPYILPAIPGGVLILACAFTKPGFIQKCRLECALWASILLLLACSI
PYISAKRALIPIPVGFLVELMVVMILITVVALLFLIKRYVARAFVLLLTLTCLLYSAFPC
FFSYFQRDQSGQMSRFILKQGDDDAQVYCAYYYFQDLPFYLHRYVGTINHVPDEQTLGYR
SEPCDRYIVSDALRYRWTLSKRIFVLVRRQQRQVFEGQMSELPLYNLTNDAYFALYSNRR

Enzyme Prediction     

No EC number prediction in MGYG000004418_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	513	3.5e-104	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.48e-54	1	393	6	392	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.43e-52	3	320	1	320	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	8.06e-15	59	220	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.98e-14	32	235	34	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	1.80e-05	44	215	76	255	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VVC73130.1	1.94e-68	6	539	18	556
BAV32474.1	1.27e-62	11	506	1	508
ACB74694.1	5.68e-61	11	331	23	365
VVC76195.1	1.05e-60	15	539	29	559
ARN84720.1	1.38e-60	11	530	15	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.51e-46	15	327	44	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FRR0	2.83e-35	13	330	17	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B7VBN0	3.43e-34	2	335	3	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	6.34e-34	2	335	3	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
B7LM74	2.20e-33	3	330	2	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
Q02R27	5.41e-33	12	335	9	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.110051	0.888428	0.000438	0.000343	0.000333	0.000380

TMHMM  Annotations     

start	end
7	26
78	100
133	152
162	193
205	224
257	279
292	309
314	333
346	364
374	396
403	425