CAZyme Information: MGYG000004390_01020

Basic Information

• Species: Prevotella sp002265625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002265625
• CAZyme ID: MGYG000004390_01020
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		66875.98	7.6085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004390	3321071	MAG	Israel	Asia

• Gene Location: Start: 13545; End: 15317 Strand: -

Full Sequence      

MKILIVTTEIGLEGGGLSLSCKRLANIISNNNSVEIVNSAVAPVQTISGGFFPQTGNYIQ
RELKLKTEAKKYQEIDIVIGFGGKFNGYYAALLAKHIKAKYILCLRGSDVNLAKWSVEDS
WYLHEASQYAVRIVCLTKEMQQNVLLADQLAENKLIIIPNSLGREYLGVSFPHLPSSVVI
GCAASHLNEKKGITNLLYMVSEFKKISELPIKLILVGDIDSDLKQGYWNIINKLSLHENV
CFYNKTSRAELIRIMKNWDFYVQGSVCEGHPNAIVEALQNGCAFISTNTGYIAEMLSPEH
PEIFFQDWIPTNMAKSLKKLVSEKNKDYIYAEVYKKLLLNCNRQQIEKEWEQLFGCKKEN
TNKYNIKHIIAVGLHDVQGDKHDSITTPTHVFQEFVEQIKLLGYGLCSMRDYLAKNAEER
QSLIVCTFDDGYSGLIDNALPILSQFDFTATVFVCTGLIGKDNKWNNKDAILRRHLNMVE
LRLLYKNGWEIASHGVSHNNLLKLTDIELGYELKHSHDFIVKEWGEAITYAYPYGAYNTF
IKNCVGKYYKYAFSVTQGGTSLIADSLQIRRYSITEIYKMLSNTSEKDSL

Enzyme Prediction     

No EC number prediction in MGYG000004390_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	419	544	4.4e-22	0.8461538461538461
GT4	185	326	5.9e-19	0.8625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	3.90e-41	424	575	2	155	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10970	CE4_DAC_u1_6s	9.11e-28	423	574	2	145	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10967	CE4_GLA_like_6s	1.62e-21	424	552	3	120	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd03801	GT4_PimA-like	3.77e-21	2	324	1	334	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd10973	CE4_DAC_u4_5s	5.34e-21	424	578	3	157	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73438.1	2.88e-228	1	582	1	582
QJR58213.1	2.88e-228	1	582	1	582
AII67656.1	2.88e-228	1	582	1	582
QJR56991.1	2.88e-228	1	582	1	582
AAZ21820.1	1.21e-20	380	565	17	199

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58459	1.35e-07	100	299	113	319	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
P94361	1.67e-07	383	538	77	225	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P39857	1.98e-07	149	324	135	326	Capsular polysaccharide biosynthesis glycosyltransferase CapH OS=Staphylococcus aureus OX=1280 GN=capH PE=3 SV=1
P39859	1.23e-06	87	369	105	387	Protein CapJ OS=Staphylococcus aureus OX=1280 GN=capJ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004390_01020.