CAZyme Information: MGYG000004371_00354

Basic Information

• Species: Prevotella sp002251385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251385
• CAZyme ID: MGYG000004371_00354
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		44696.15	8.5807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004371	2690194	MAG	Israel	Asia

• Gene Location: Start: 24725; End: 25903 Strand: +

Full Sequence      

MRLDKYLFIIFALLFMACQHDKKVEQTPWGTSLETNTDSISTDYTFNDILNNGEIIMLTL
SGPQTYYEYHGRGMGTQYLLCEKFAQTLGVSLRVEVCKDTAELVHRLKQGEGDIAAIPLP
HSIHGIRFCGVSYPKDKTSWAVGDANTALADTLNRWFKPVMITQIIKEQEFALSIHSIKR
HVYSPMLDKGAGIISKYDHLFQKYAPVARIDWRLLAAQCYQESTFDPKARSWAGACGLMQ
IMPETADHIGLPRHLLYEPEANIAAAVKYIAQLNEKFRDVPDKAERTNFVLASYNGGYHH
IRDAMALAKKHGKAPHHWRDVAGFVLGLHECRFYNDPIVKYGYMRGHETVDYVERIHARY
GQYRGSASSCSFQGSYANLEPQRAKKKYKYHI

Enzyme Prediction     

No EC number prediction in MGYG000004371_00354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	211	365	3.6e-27	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.28e-76	201	364	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.39e-53	5	360	7	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	4.37e-45	53	365	23	433	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	3.30e-25	197	302	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	6.56e-24	201	316	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	5.88e-171	5	392	4	391
QUB48180.1	6.28e-166	17	392	18	392
EFC70077.2	5.12e-165	5	392	4	391
AGB28026.1	1.64e-161	5	392	23	413
BCS86517.1	8.02e-159	17	392	9	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	3.93e-22	194	360	256	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	4.15e-22	194	360	263	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	4.15e-22	194	360	263	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	4.66e-22	194	360	249	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	4.66e-22	194	360	249	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	9.96e-32	86	356	165	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0KJ50	1.63e-28	49	360	43	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
B0TLJ6	1.44e-26	54	360	35	437	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1
A8H256	2.76e-26	194	360	277	437	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1
A1U3J1	3.30e-26	194	360	283	445	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004371_00354.