CAZyme Information: MGYG000004354_00917

Basic Information

• Species: Alistipes sp900548155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900548155
• CAZyme ID: MGYG000004354_00917
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890		99432.42	6.5157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004354	1972014	MAG	Israel	Asia

• Gene Location: Start: 1990; End: 4662 Strand: -

Full Sequence      

MKRLLIVSALLFPSLLSAQVAVTSLRTDRLDAPRGISPENAPTLSWIIESPAKNTVQTAY
EVTVRRNGRLVWQSGKVDSDNSTNVKYDGALLPDSRYDWSVRVWDNHGNVSKRASSSWHT
GLRHGDWQAEWITGSTEKLKPVYFRTERTLKKRITRATAYITAHGLYEAYINGRRVGDYY
LTPGWTSYNKRLQYQAYDVTGLLKSGRNAVGAVVSAGWYSGGLNYVSPSKRYRYGDDIAL
LMQINVEYSDGTKEVIATDGEWLQSGGEIVFANIYDGQTVDARFADKAWATVDCPQWTDK
ATVAGFAKDNLVATENEPVIKHVSLSPVKYIVTPKGEKVLDFGQNIVGWETARLRGKAGD
TVRIYHAEILDQNGNFYTTNLRRAKATSTYILRGDAEERFEPTMTFYGFRYIKVDGVDGD
LNPDDFTAEVVYSGFGKSGEFASSMDIINRLQSNIEWGFHDNFVDVPTDCPQRDERLGWT
GDAQVFFRTASFLGNVDSFFRKWLSDLSADQYSDGRVPKIIPDTFPVTREGRNGATGWSD
AATIIPWQHYMAYGDASVLEKQYPSMKLWVDYMISESRDRGWLWNTGVHYGDWLFWSKPN
DPDGKSAVTSQHLVAQCFFANSVDILRRAAELLGKNDDAAYYADILHKVRKAYLDEYVTP
NGLISSDTQTAYVLALHFDLLPENLRAQALDRLVANIERYGDHITTGFLGTPYICNVLTD
NGRSDVAYRLLLQKTCPSWIYPITKGATTIWERWDSIRPDGSIIKGMNSFNHYSYGAIGD
WLYRSAVGIRETSAGYKTIAVRPHVGGGFEWMKASTVTPYGKVAAEWHAEGDALTSLDVT
IPANTTAEIFVPAADAESVAASDPSLKPSGFADGYAKFAVGSGTYRFTVK

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	333	849	2e-180	0.9880952380952381
CBM67	129	299	1.4e-31	0.9261363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.20e-131	439	784	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.71e-58	152	322	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.61e-37	333	432	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.62e-18	788	859	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	3.99e-04	547	653	109	206	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT48222.1	0.0	18	888	13	899
ASU32381.1	0.0	2	889	3	905
QQR16617.1	0.0	17	890	18	895
ANU59845.1	0.0	17	890	18	895
AHF16391.1	0.0	8	890	9	897

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.75e-200	22	890	6	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.44e-174	39	859	20	854	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	6.13e-146	33	890	43	942	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.20e-199	22	889	6	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.55e-176	42	859	55	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.62e-163	39	868	48	894	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.68e-110	41	859	50	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000347	0.998884	0.000210	0.000196	0.000167	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004354_00917.