CAZyme Information: MGYG000004348_00722

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004348_00722
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000004348_3|CGC1	43442.26	6.4976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004348	1551350	MAG	Israel	Asia

• Gene Location: Start: 141502; End: 142632 Strand: +

Full Sequence      

MRIITVRLRWGFVLAGALLAAFTADAQHKLCNPSATQEAQKVYSALWDVYQKQTLSATVA
NVDWNIKEAENVHEWTGKWPVMNVFDFINFHNSKDVNPKGWLDYSDITQVEAWWKAGGLV
GCMWHWNVLANNGKDLTCTPGTEPGQTSFDVSKIDDISSKEYKQIVKDIDQIAKYLGKMQ
DAGIPVIWRPLHEAAGNIYEFEGGKAWFWWGCGGAETYKKLWRLMYHRLVDEHKLNNLIW
VWTSQVADSTWYPGDEYVDVVGRDNYKALQYPLMKEYKTLSERYPGKIVALAECGNGDEV
AMSPWSKIWQRGSRWCWFMPWYDYSYNARQSEEHKFAGKDWWTDAFGSGTVLDRDAFKAL
LGKTYKYVLVKDDQVL

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	32	355	1.5e-83	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.31e-49	32	324	2	285	Glycosyl hydrolase family 26.
COG4124	ManB2	1.01e-14	147	266	142	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	7.63e-111	38	355	126	443
ARK08557.1	1.06e-92	30	360	142	455
QIK58757.1	2.98e-92	30	360	142	455
QIK53340.1	4.21e-92	30	360	142	455
AHW58761.1	2.93e-88	32	360	49	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	1.83e-84	29	354	44	353	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	9.11e-77	30	355	4	332	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	2.08e-72	30	355	95	423	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3ZM8_A	1.75e-43	10	323	120	418	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	8.88e-43	32	355	36	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	1.33e-51	29	323	145	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	7.76e-43	10	323	149	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	5.08e-36	10	367	128	469	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
Q5AWB7	7.92e-36	12	321	10	319	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	2.52e-35	12	367	138	471	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002227	0.996032	0.000859	0.000313	0.000267	0.000265

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004348_00722.