CAZyme Information: MGYG000004336_02048

Basic Information

• Species: Faecalibacterium sp900765105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900765105
• CAZyme ID: MGYG000004336_02048
• CAZy Family: GH105
• CAZyme Description: 24.9 kDa protein in picA locus

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
148		16457.8	4.9528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004336	2379489	MAG	Israel	Asia

• Gene Location: Start: 4; End: 450 Strand: +

Full Sequence      

MDEQLYNEYRGIMAMLKATVEDLHKFQDEETGMFWQVIDHPGVEGNYLETSGTALFAYAV
LKGVRLGYLPKRMAAWAEKAFYGTCDKYLSRNPDGSLQLDGICLVAGLGGKDHRDGSLAY
YFSEPVVCNDAKGVGPLVLAYTEMIAKR

Enzyme Prediction     

No EC number prediction in MGYG000004336_02048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	6	145	1.2e-39	0.3825301204819277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.15e-27	7	144	228	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.18e-26	12	145	218	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK99741.1	7.74e-103	1	148	234	381
AXA82451.1	3.13e-102	1	148	234	381
ATP00557.1	3.60e-101	1	148	234	381
QIA43718.1	3.60e-101	1	148	234	381
AXB29657.1	4.15e-100	1	148	234	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.64e-38	6	143	220	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2GH4_A	1.37e-18	16	144	233	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
1NC5_A	1.46e-18	16	144	243	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3QWT_A	6.85e-09	10	97	258	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.02e-07	10	147	259	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3U6	1.25e-26	30	145	108	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.25e-26	30	145	108	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O34559	7.99e-18	16	144	243	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004336_02048.