CAZyme Information: MGYG000004329_00487

Basic Information

• Species: Prevotellamassilia sp900539625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900539625
• CAZyme ID: MGYG000004329_00487
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	MGYG000004329_5|CGC2	98169.28	8.5686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004329	2571737	MAG	Israel	Asia

• Gene Location: Start: 55734; End: 58367 Strand: +

Full Sequence      

MKKFIFIALTSLVCWGGKAQTSEPDYPFRNAHLSASERTEDLISRMTLEEKIDLLAGYND
FYLHPCARLGIPAFRMADGPLGVASWGLWGRATAFPAALSVAASWNRDLAYRIGEMYAAE
WRARGLHFMLAPGVNIYRASKGARNFEYYGEDPVLTSQMIVPFIQAVQKGGVIATVKHFA
GNDQEFDRYTVSTEVSRRALHEIYLRPFRAAVEEAGVKAVMTGYNPLNGTYCTENKWLID
VLKKDWGFKGMLMSDWACTYSADKAANNGLDLEMGSKDWFNRQRLLPLIKNGTVSEATIN
DKVRRIYGTCIEMGFFDRDQRIDTIPLYNPAASRMALKGAEEGMVLLKNSNLLPLKSPRR
IAVIGPTANPPLINDRAFNTNGIVYGGGGSSRVHPWHVVNDLEGIKNEFPEAEVLYAEGI
SNQFRRRLFQSSVFKTADGRQGLDARYFSIGKDHAATPATDVLAQQAKAAGRETTQAVSA
ATAGKGDTLMRRTDRQVNFEWWGTPDGKYQFGDEYGAEWTGFVDAQKTDSLRFFVDAQGA
YELFVNGKLLADASRSQSFHFSSPAVWAEKGDRLEILLKYRSQRSHPSEIRLGYCNDSDL
DFSEAKRIAAKADVVVFCAGLDGSIELEGRDRPFDLPYGQDRLIRELCRVNPNTVVVLHA
GGGINMTPWIDSCAAAIHAFYPGEEGGNALAHILSGKVNPSAKLPFTIERRWADSPAAGN
YDETRREKKIYYREGIFTGYRGYEKRNIAPLFPFGYGLSYTTYKYDDLDVRITDRSRATV
TVSFNVTNTGKMAGGEVTQLYVADVKSKEPRPLKELKAFEKVWLQPGETRRVTLHLSARD
FEYYSEKADRWVFEKGAFIIKVGASSQDIRLEKQIKL

Enzyme Prediction     

No EC number prediction in MGYG000004329_00487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	274	6.9e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.47e-87	1	870	1	758	beta-glucosidase BglX.
COG1472	BglX	8.71e-77	67	369	56	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.16e-54	4	838	7	750	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.47e-48	597	760	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	7.96e-47	68	306	63	313	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ49055.1	0.0	1	877	1	878
QRO24110.1	0.0	3	877	2	878
CBW21489.1	0.0	22	877	22	883
CAH06603.1	0.0	22	877	22	883
QCQ40606.1	0.0	22	877	22	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.45e-123	40	877	7	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	1.89e-119	42	877	8	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3ABZ_A	1.79e-118	40	877	7	836	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.25e-100	37	872	2	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.78e-99	37	872	2	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	3.14e-142	40	877	3	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
B8NDE2	1.91e-138	40	869	7	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
Q2U8Y5	1.04e-137	40	869	7	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
A1CA51	4.80e-134	40	869	7	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
Q5BFG8	1.13e-133	40	877	12	838	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001543	0.728251	0.268919	0.000685	0.000327	0.000253

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004329_00487.