CAZyme Information: MGYG000004319_01039

Basic Information

• Species: CAG-273 sp000438355
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-273; CAG-273 sp000438355
• CAZyme ID: MGYG000004319_01039
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1068	MGYG000004319_8|CGC1	122355.13	4.546

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004319	1434556	MAG	Israel	Asia

• Gene Location: Start: 5352; End: 8558 Strand: +

Full Sequence      

MQKYGMLKFLISLLMIILIMQFSLASFYNVFAESNTEIAQHDETSQKNEEINFHYLSDME
YITTNRWSYAGYGSIMKDKNINGEKISLIIDGSKIIFNKGIGAHASSQLTYDISEYSDEY
TRFVAKLGIDSSQNGQGDVWFRISVSNDGTEWKELYKSEPITSNQSAYAVDIDISNYKYL
RLYADQNGGNGNDHSVFGDARLVKRDYDLNSELYQGVHRLEYYDEILSKNNVDYNYENNL
KIVLEREFVNRVGFWTIQDVVSKGGEDIINVINWLKNDSDALELFINSGEIKNGATCLNA
LSQLYKNYKDVIGSDGDAYVYKKMLIALAVAYSSDIVASPLRFNTSIGSYDVVKRFELVK
KLYDDNLFLRKEEFKSYNMELMRFVMNDSIANEEVLWLRGYSEDRYPDNINVKLNPYSYM
NYVSPNYNREEYFDMANKDKYDTKYELSKYNVSFGEDKTVKTWMSMEAGGICWNISRLGQ
NLYKVHGIPAVGTYQPGHEAYFYYTQDNNGNGMWNIGNNISGWGKSFTSWYGGNIYRLLL
GWGNKSYNSMRTNNSSYLLLAQGALNDYENYKKSFYYNLISNSYSDYKIKEKILEKSLEC
LNINLDTYEDLINLYKTENKTTEEWKELANKIIQTYTYYPIAMVDLLNLIYPYLSQEDTI
TIDILKTEALNNALNATNKESLQPNACKEVAQSLLGENLVELASFSFDGEDARKIVINSK
YDDYEFQVRYSLDGGSTWKTTLEHKIELTKEEITSITAENDIHVQISGSNEVYVIDILKG
ENISNELLDGNDDENRFIGKIENLEYSLDGGITWTDYSSDIEFTGDKVVQVRYKAHGIYL
EGEAMEFKFTDIPDITTTYIPVKYINFVSAAESQDDQPATNMIDASPFTTWHTKFGKVAK
DKAYVTVFDKERVLSQITYDPSGGANGRIKDVEVYVSLDGKNWTLSGKATNWSNNKERKI
LKLSEPKKAKYVKILATATYSNGMEEENKYVSGVRFNYYEDVTKTIKLGNINNDEVIDIL
DLSILNKYLLGLTNIEGIVSKMAADLNEDGEIDILDLSMLNKIIIDAK

Enzyme Prediction     

No EC number prediction in MGYG000004319_01039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM51	55	202	3.7e-29	0.9850746268656716
CBM32	871	981	3e-17	0.8145161290322581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	2.02e-38	55	202	4	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	1.18e-18	55	202	6	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
pfam00754	F5_F8_type_C	9.35e-13	868	983	2	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd14256	Dockerin_I	1.68e-11	1008	1064	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	6.13e-10	1009	1064	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL58565.1	0.0	53	1022	80	1077
QUF62688.1	1.33e-230	33	1014	120	1109
QWN61334.1	1.33e-230	33	1014	120	1109
QTZ56174.1	3.71e-230	33	1006	122	1104
SQG16429.1	7.35e-230	33	1006	122	1104

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JS4_A	4.59e-15	40	203	598	753	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
2YGL_A	1.99e-09	55	174	191	321	TheX-ray crystal structure of tandem CBM51 modules of Sp3GH98, the family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 [Streptococcus pneumoniae SP3-BS71],2YGL_B The X-ray crystal structure of tandem CBM51 modules of Sp3GH98, the family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 [Streptococcus pneumoniae SP3-BS71],2YGM_A The X-Ray Crystal Structure Of Tandem Cbm51 Modules Of Sp3gh98, The Family 98 Glycoside Hydrolase From Streptococcus Pneumoniae Sp3-Bs71, In Complex With The Blood Group B Antigen [Streptococcus pneumoniae SP3-BS71],2YGM_B The X-Ray Crystal Structure Of Tandem Cbm51 Modules Of Sp3gh98, The Family 98 Glycoside Hydrolase From Streptococcus Pneumoniae Sp3-Bs71, In Complex With The Blood Group B Antigen [Streptococcus pneumoniae SP3-BS71]
2VNG_A	7.49e-06	55	205	12	175	Family51 carbohydrate binding module from a family 98 glycoside hydrolase produced by Clostridium perfringens in complex with blood group A-trisaccharide ligand. [Clostridium perfringens],2VNG_B Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by Clostridium perfringens in complex with blood group A-trisaccharide ligand. [Clostridium perfringens],2VNO_A Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by Clostridium perfringens in complex with blood group B-trisaccharide ligand. [Clostridium perfringens],2VNO_B Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by Clostridium perfringens in complex with blood group B-trisaccharide ligand. [Clostridium perfringens],2VNR_A Family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by Clostridium perfringens. [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.165799	0.826161	0.006332	0.000822	0.000416	0.000433

TMHMM  Annotations     

start	end
9	31