CAZyme Information: MGYG000004292_01657

Basic Information

• Species: UMGS1474 sp900552115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1474; UMGS1474 sp900552115
• CAZyme ID: MGYG000004292_01657
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1387		151338.8	4.6267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004292	2231746	MAG	China	Asia

• Gene Location: Start: 4211; End: 8374 Strand: +

Full Sequence      

MRKTWRKTAAVLSAGCLLAGGWPGMAAAGSGQTKEAGTVRPRQGLSYTYPTDYADWANGF
MSGNGKMGIIVFGNPLDDTVVYNDRGFNKAANVNTPTRTFNEVSGKMLQDIKNACASGDF
KTANDLAFEAHGWKDGGDGNRHPGYKMQITIPEDGEVTGYSRVCDFTTGEIKVNWSDNRG
DWTRSSFVSRRDNVVVQQLSAPTQGKLTCSIVLGIDPEMKMFGGMTYSQNNTTQILNFRA
KYGPGTGDAGYEGVTRVEAKGGRLQMEGDVLKIEGADEVLLLTQTEKYRSDSGAAWDKEA
IQKRLFSVSADYDTLLQGQKDTHTAIYNRVSLDYNASPQERALSNEELLARQKAAGQPVK
ALYERLFDAGRYYFLCSGYEKSVADLGGIWAGDTNAGWGGFYHLDANLNLQMAGGVIGDM
PEVMEGYFHLNEAWEEDFKTNARKLLGCRGLLAAGNTPGGQSGLISSLNYDYPYQYVTGE
EAWLLYPFWEYYQVTGDKGFLENRLYPLLRQMGDFYEDFLTEKDKNGQYIFAGSISPENK
PANLNLSLVNNSTFDISSARFALSTLINICGILGTEQGRGEGVERWSAMLDQFPSYMVND
DGALKEWAWEGLEDNYGHRHSSHLVGVWPYREITPEADEDLYDAALVALKKRDAHYTGLQ
GHGVIHDALIAANLKNASSLAYRLRQITTEDFYYDGLISSHDGGHKTFCTDTCNTLPAIM
MEMLISSDAGMLEFLPALVDGLDTGSVSGVKGRNQTTIENLSWDRQAKIVTATVRSDIDQ
TLTVIERQGIVKMDTAAPVRHSSLGRIARDVTLTAGESTTIVMHLDDVDEAAGNLALGKP
AVASSIDDPTRTADQAVDGNYSSRWSSGQFDNSWIYVDLGQAYSLTAVVLEWEAAYAKAY
KLQVADDPAGPWTDIYETDNGKGGSETVPVKGAGRYVRMLGSERVVVNGSKWGYSLYEFE
VYGQSPSKDGNIARYRPVTATSQADEAHSADKALDGDHATSWRSGREAVSSLVIDLGEEY
KLSGLTLVWGEPYAAAYTVQVSGDKYSWNDAYTTAKGSGGSEKVALDAAGRYLRLQMTAS
SGEGFELMECEAEGETTAPPPADKTALKEAIAYPITQEVYTPASLEAYREALEAARAVAA
DKKALQSAVDGALATLLQARQRLERRYLGETIGRFPASGKTYTANKSVLGSDTIMAEEPI
NLRGRDLSRLYILMTVTLTNDSVTEDGAAFATGKLRFGSPDINGQKNDIAYDIAGMKLAL
HKGENLLYFPIADTATGYFETGDGEIDWSRLDRFRMYIDSLNQYPGSFTMTIGDILILDS
DAVKQGDINGDGEVAAEDALMALQAATQKITLTDRQKRAADVNGKDGVTSADALLILQYA
TKKITGF

Enzyme Prediction     

No EC number prediction in MGYG000004292_01657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	45	786	4.2e-148	0.9750692520775623
CBM32	844	960	5.6e-23	0.9112903225806451
CBM32	979	1081	9.5e-20	0.8306451612903226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.25e-26	45	282	1	224	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam00754	F5_F8_type_C	2.27e-14	977	1084	1	119	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.03e-13	840	939	1	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd14256	Dockerin_I	2.57e-12	1326	1379	2	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	2.18e-08	1326	1379	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWS40336.1	0.0	45	1112	997	2056
ASY31818.1	1.09e-304	46	963	193	1106
BCB78140.1	5.09e-300	41	962	180	1097
BBE20411.1	4.42e-293	61	828	1	764
QDO67853.1	1.23e-276	42	782	26	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	1.52e-41	45	787	5	755	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	1.55e-35	43	784	20	741	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	2.51e-28	25	777	21	750	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	1.98e-26	63	758	55	825	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2RV9_A	2.21e-26	834	963	7	136	Solutionstructure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.26e-38	45	763	52	792	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
Q5AU81	5.69e-12	51	769	33	781	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000692	0.996807	0.001497	0.000514	0.000265	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004292_01657.