CAZyme Information: MGYG000004290_00075

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_00075
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41238.93	9.6437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 2220; End: 3314 Strand: -

Full Sequence      

MKKTIIALAVSLAALSAGAQQPVPTGRFADAVNHWNKEHGAQAYERYKPEQFREIAGNIV
AYQNADGGWPKNLDMLARLDPDSVKAALKPRHRLSTLDNANVYTQVEYLSNVYALTGDTL
FRNSARRGMEYMLAAQYPNGGWRGWDADAVTFNDGIIYGVLSTWNEVLSGKSLYTWVDDS
LKSRIRASWDRGIELILKTQWVQDGVRTVWAQQYDHETLQPVKARAYELPALSAGESADI
TMLLMRIKKPSPEVVEAVKAAAAWFDRTKITGKKVVTVAVPEGLEEDRKIKRDRVVVDDP
GAAPMWPRYSELADNRPFFATREGVKVYDLREVPAERRVGYSWYGTWGNKVLKKYPEWLR
RIEK

Enzyme Prediction     

No EC number prediction in MGYG000004290_00075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	63	351	2.2e-94	0.9965277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.08e-97	63	352	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.50e-95	63	352	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd02889	SQCY	0.004	61	205	80	208	Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. Bacterial SQCY catalyzes the convertion of squalene to hopene or diplopterol. Eukaryotic OSQCY transforms the 2,3-epoxide of squalene to compounds such as, lanosterol (a metabolic precursor of cholesterol and steroid hormones) in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain. This group also contains SQCY-like archael sequences and some bacterial SQCY's which lack this minor domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37157.1	6.59e-112	29	363	31	365
QDU41600.1	1.45e-105	18	362	44	390
QDT46035.1	1.33e-103	18	362	44	390
QDU80650.1	9.78e-94	21	362	44	387
AFN74742.1	6.07e-91	28	364	34	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	2.03e-50	47	361	78	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.27e-45	59	352	40	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.89e-44	59	352	40	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999068	0.000218	0.000174	0.000160	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004290_00075.