CAZyme Information: MGYG000004276_00395

Basic Information

• Species: ER4 sp900550165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; ER4; ER4 sp900550165
• CAZyme ID: MGYG000004276_00395
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000004276_4|CGC1	42623.89	6.2403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004276	1949954	MAG	China	Asia

• Gene Location: Start: 6122; End: 7294 Strand: -

Full Sequence      

MSKIVFFCIPAYGHTNPTLGVVRELVARGHEVRYYSYEPMRPLIESAGAQFVACDPYDCE
QRLTPADGARVGRDIAFSTHILVETTLALDEFVCADMRAFAPDCIVADSMAVWGKAVAKK
LGIPFVSSTTTFAFNRYSAKIMKQSGGQMLKMLLSMPKINRDLQRLRDRGYPIKSILDII
QNDDQTDTIVYTSPEFQPCADTFSDKYAFVGPSIRPAAETIEKSRDTLVYISMGTVNNDL
LPFYRACIAAFADSPYQVILSTGEQIDRSALGTLPDNITALPHVDQIAVLQKADVFLSHC
GMNSASESLYFGVPLVLFPQTNEQGGVAARVAELGAGATLEKADALSIRAAVDTVLQMPS
YRANAQKISESFHRCGGARAAAEKILSLCR

Enzyme Prediction     

No EC number prediction in MGYG000004276_00395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	10	388	1.3e-48	0.981675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	4.44e-101	7	390	1	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	7.06e-74	1	390	1	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.28e-70	3	388	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	2.68e-13	13	388	11	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00201	UDPGT	1.39e-09	229	373	278	423	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK99922.1	5.06e-159	1	388	1	388
QWW19688.1	1.25e-150	1	389	1	390
AVP65214.1	6.15e-139	1	389	1	387
ACA54275.1	9.02e-139	1	389	1	387
AJD26746.1	4.99e-138	1	389	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	9.10e-51	9	385	11	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.02e-50	9	385	11	381	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
3RSC_A	4.37e-41	2	385	21	408	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	4.45e-41	2	385	21	408	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
6J31_A	3.09e-38	2	385	5	390	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05496	1.83e-53	1	390	1	391	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
O31853	4.83e-52	1	386	1	393	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	5.60e-50	9	385	11	381	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	2.82e-45	2	385	4	386	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	1.39e-37	1	388	58	456	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004276_00395.