CAZyme Information: MGYG000004265_00775

Basic Information

• Species: UMGS263 sp900540535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS263; UMGS263 sp900540535
• CAZyme ID: MGYG000004265_00775
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000004265_3|CGC1	46614.36	7.9699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004265	2478899	MAG	China	Asia

• Gene Location: Start: 25902; End: 27131 Strand: +

Full Sequence      

MKEHLNVGVIGLGGRGIGLLQLVMYRMKDITVTAVCDVYEDRIEQAQKLAKKMRRSEPKG
YTDYHEILNDKSIDAVIITASWSAHSKIALDAMRAGKPVGMEVGGAYTVDECWDLVNCYE
ETKTPFMMLENCCYGEYELAVLRMVREGIFGDVVHCGGGYKHDLRYEVSFGEKNRHYRLH
EYMTRNCENYPTHEIGPIAKVLNINYGNRMVSLTSTASCAKGLHRYITDRMDKYDNLKKL
KDVEFAQGDIVTTVIKCANGETISIQLDTTLPRMYSRGFEVHGTKAYYTEDGNTFVNDNH
NLKYEGIKSSGKRMVKKYRHPIWKWFKRFGVKGGHGGMDWLVFKAFFDAVRKGDGHTPID
VYDAACWMAITALSAQSIENNSACVEFPDFTRGEWKTRKQKGEGMFFLE

Enzyme Prediction     

No EC number prediction in MGYG000004265_00775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	398	4.5e-141	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.83e-17	28	380	28	334	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.04e-07	23	128	19	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	1.22e-159	3	398	2	398
QTH41319.1	1.58e-154	1	395	4	397
QJD87109.1	2.49e-154	1	395	1	394
QTH43530.1	2.42e-152	1	399	1	399
QNK55026.1	7.19e-149	1	399	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.62e-99	3	399	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.98e-66	4	397	42	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	1.07e-12	5	121	24	136	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3EZY_A	1.40e-07	5	129	3	118	Crystalstructure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
3NTO_A	5.87e-07	5	156	3	153	Crystalstructure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis],3NTQ_A Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTQ_B Crystal structure of K97V mutant myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD [Bacillus subtilis],3NTR_A Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis],3NTR_B Crystal structure of K97V mutant of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NAD and inositol [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	8.87e-99	3	399	19	435	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	1.80e-95	2	399	65	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
B2FLK4	6.67e-92	3	399	32	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	8.09e-87	5	399	50	461	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
Q8ECL7	7.89e-82	3	402	53	455	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004265_00775.