CAZyme Information: MGYG000004223_01305

Basic Information

• Species: UMGS1883 sp900763305
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900763305
• CAZyme ID: MGYG000004223_01305
• CAZy Family: GH1
• CAZyme Description: 1,4-beta-D-glucan glucohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000004223_9|CGC2	50014.96	7.1115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004223	2575981	MAG	United Kingdom	Europe

• Gene Location: Start: 79824; End: 81098 Strand: +

Full Sequence      

MYDIFSLPEFKFPKGFLWGSGVAGHQVEGNNIHSQYWWDENNTDKYEEKSGMACNHYNMY
REDAGLLKKLGHQAFRFSVEWSRIEPSEGNFNEEAISHYADELAALKEKGIKTFVTLVHF
TVPLWFERLGGFRKAENLKYFQRYVKKLVPRIFRYVDFWNVINEFNLGNTEEKILHKLNS
IIYHAEGYHIIKEHTDSPVSSAHALVYYMPYRAFDKFDRIMTDYRDWQDNEFFFHAIRTG
EIVYPGRAARFCRDVKGTCDYWSVNCYVRDMIDSRKASGSGERYAHKVLKMIDMPFYLEE
MYPEGMLSILTRLNDLPVYITENGCSCNDDRFRIVYLALYLSALSDAIKCGIDVRGYLYW
SLMDNYEWGSYKPKFGLTAVDRKTFERKLKPSALFYREIIENNGLNQEIIRRYLSEMPSL
SLKA

Enzyme Prediction     

No EC number prediction in MGYG000004223_01305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	10	404	3.6e-96	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.48e-83	11	410	3	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.51e-70	12	404	5	452	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.28e-43	10	402	3	465	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	1.24e-31	12	403	30	483	beta-glucosidase
PLN02998	PLN02998	1.90e-31	12	401	31	486	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	3.27e-181	1	422	1	419
ADW18818.1	1.90e-179	1	420	1	432
ADQ08048.1	9.83e-154	1	420	1	426
QCX34294.1	1.09e-141	1	420	1	424
QNM13665.1	6.41e-131	1	420	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	9.47e-71	11	422	4	423	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	1.97e-58	9	408	8	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
4R27_A	1.91e-54	12	393	7	402	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	1.03e-51	14	393	34	421	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
7E5J_A	2.89e-50	12	405	6	446	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10482	2.73e-48	9	404	2	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	2.23e-47	11	405	3	442	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q08638	3.30e-46	11	405	5	444	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P26208	2.50e-45	7	404	1	447	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P22505	9.38e-42	10	404	6	447	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004223_01305.