CAZyme Information: MGYG000004220_00541

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004220_00541
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1469		157112.03	4.2389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004220	2131393	MAG	United Kingdom	Europe

• Gene Location: Start: 2697; End: 7106 Strand: +

Full Sequence      

MFGENFLVAPVYQDTQADENGNDVRNGIYLPNYGTDENPTIWIDYFSGKQYRGGQVLNNY
EAPLWKLPLFVKANAIVPMYAENNNPEAVTETNTKGTNRSQRIVEFFATEGEGSFTQYED
DGSSIENNTTEDDSYGTIDNISYGEHVSTVYKSSVVGGTATFTAEASQGGYSGYDSNRTT
TFVANVSAKPTSVSAKNGGSALNVVEVDSQEAFDAATPEAGQAVYFYNETPNLNHYGSDA
GSTEAEQGESFNNTKITTNPKVYVKFAKTDVATAAQTLELGDFVNADATLAADRFNENLS
APANLAAPEDATTPTSIKLTWGKVDGATSYDLKVDGTVFAVGDAAEFTHTDLAYNSKHTY
QIRSRNADGYSAWSDVLEANSALDPWRNVPEAEEITWEGSLYGSHKAELAFDHEFQSGDG
GFHSGGNDLGKALTVDYGRAYKLDKLEYYPRDDAGNGTVTKMRIETSLDGVHWTTQEVDW
ERSAACKTVAFDGAVAARYVRMTPLASVGNFFSASEIAIYKTDGTDGFAVGSNLNKATVS
DGDYSNMKNYLGLENREPDTSTFDSQIRAHFADLNGNGVYDVYDYSFTMAALDGGTKQKG
KAAGTLAVIPSKMEVEAGDEITVDVYATDAENINALGALVNFNSDQFEYVSESIAQDAST
AGMENLSREKVQFTDGHQTINLAFANRGDAKLFNSTGVVASFKLKAKTAGKVELPSTSWL
VGPACDALEFVSDGTVTMPGVPQPTKSEYGRDAFDITMTNDELPTDDGTNVEKLIQQKSY
DGLFDNNEGGNDFEFLWNYGPNWIDGKMPTYVKLPATMTFAFKTPSKLDSVEVVNRNGGN
GTVQKIKSVVTFEDGSTQEFSGGSFDSYQARYAFGLSAENKGKKATKVEITPLEASGDQM
LTLREINFNYTQGVEAIEGVELGKNQTEFFEGDVTLVDAKATPESAGYPYVTVESSDPSV
VSVSAVQAGDSVSYYLRANKAGKATITVASVLDPSKTASYEVEVKAGVDTSALMAALSKA
AGYSESVYTKDSYAALTAAVEAAQKLLDGGQGSYSKKDVADATAKIEKAIDGLKMRPVDE
KSLINTPENRENVKVTGFSSEADYEGSNAVNALDGDEQTLWHSDWAYKAGMPQYLTVDLG
RDYDLTDVTFLPRQDGGTNGDIFEAEVLVSDTADGYEMGTATSMGTFTFDNDGRVLTDRG
DWKQMSFGAARGRYVTVKVLHAGGGSVDAYCSMAELKFYGTAVPNPVAKDDLTAAIEKID
AEVAAGDLKASDYTEASWTAFQNALASARAILNDENATQDEVDQALKALESARDALEKTP
VTPVENPTKKQLKALVKQAKETDTRGKTDESVKALTDAITYAEDVLGDENASDIQLQAAY
DQLKLAIESLKDADSGNQGGSGNQGSGNGSNGGNQAGKPAGDKAQGSKKSGSAIPNTGDQ
TAATVAAVGGLGAIIAAIGAFFHRRSKAK

Enzyme Prediction     

No EC number prediction in MGYG000004220_00541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	400	517	6.2e-16	0.8870967741935484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08759	Type_III_cohesin_like	6.41e-36	604	771	1	167	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.
pfam00754	F5_F8_type_C	1.61e-17	394	510	1	118	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG1501	YicI	5.55e-15	1	159	609	740	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.32e-12	1	77	381	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06596	GH31_CPE1046	1.99e-11	1	48	297	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT17625.1	0.0	3	1444	689	2140
QNM10857.1	0.0	1	1397	662	2018
BCT46261.1	2.36e-313	1	1392	666	2041
QOY60737.1	2.61e-290	1	776	80	848
BBK61154.1	1.35e-259	1	1398	678	2075

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F7R_A	2.60e-48	1	387	618	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	2.60e-48	1	387	618	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6M76_A	2.60e-48	1	387	618	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
4LPL_A	1.08e-20	366	521	23	182	Structureof CBM32-1 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124]
4LKS_A	6.70e-14	1099	1240	32	166	Structureof CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LKS_C Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LQR_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124],4P5Y_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with N-acetylgalactosamine [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH9	1.59e-08	1194	1392	1610	1805	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
Q0TR53	2.34e-06	433	520	672	766	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.34e-06	433	520	672	766	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999363	0.000616	0.000028	0.000003	0.000002	0.000025

TMHMM  Annotations     

start	end
1441	1463