CAZyme Information: MGYG000004214_00945

Basic Information

• Species: UMGS902 sp900761025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902; UMGS902 sp900761025
• CAZyme ID: MGYG000004214_00945
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		84504.96	5.8535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004214	2122522	MAG	United Kingdom	Europe

• Gene Location: Start: 2040; End: 4421 Strand: +

Full Sequence      

MKKSLLMLACALLLAFAMTAAVGAYEFVPGSDAVVYVNGTAGNDANSGKTPAAAVATPKK
AQSLLPQGGTVVVSGATALTAAYNPDAVAGAVLYTSVYGGTDYRKAGAKLSIGGNMSFAN
DTYFDNIELSITKANLFFAGKFHNFGFGAGVACKQAVTAAAFNYPVILAGVNAPQTLAAA
SSDADFTLTIAGGTWRSFYGGNRRTSASQVLGKVSGNSYIRIEGGVFTGSGGEYASLGGA
NIHTGKMVLEILDGVFNCEFFMFRRTQARPTDTSKDAGGNGTAQAVFLIRGGQFNNHIAS
GPDATIAGSLRNYANLTMVITGGSFADDMKLFNRSVMGTVLIRCSAETEAMLRPHIENIH
NFLFSNDLSPATGDTETAHFAGMISDTPDPFVFEKDGMYYIAYTDGNAISVSASREMVFS
RFTYNKVSVFNSTMTDIANAKHEYWAPEIHYFSADEVGTADAGWYIYFAADDGKDANHRM
YVLRATDPEDAQSTYEMVGELKTAENCWAIDGTVLRLGGKLYFVWSGHAKGADVQQIYIQ
EMASPTKMKGSTRTLLAAPTENWERRNSPLLEGPQALVLDGTVHIVYSANGSWTRRYCLG
MLTLVGSNPLSAAAWQKSDGPVFEMSTETSMFGTGHASFVENSLDGTHWIYYHAVPDASV
KDGNDASGTPVFWQARRTFAQQFTTETKRVGGKTLTYPVFGTPTAASTVRDVSIHTPDVC
TDAHFFAAGSDTCLICRGDSTTPVVPRYGDLDGDGKIGLSDALQLVRSIATGKLDATVTD
VLALLRYIVVGSN

Enzyme Prediction     

No EC number prediction in MGYG000004214_00945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	384	687	8.6e-79	0.9659863945578231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18820	GH43_LbAraf43-like	3.42e-105	388	655	1	258	Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08980	GH43_LbAraf43-like	1.43e-56	389	654	2	275	Glycosyl hydrolase family 43 proteins such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities. In addition to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) familiesGH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18817	GH43f_LbAraf43-like	7.48e-48	389	654	2	261	Glycosyl hydrolase family 43 such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with alpha-L-arabinofuranosidase (EC 3.2.1.55) activity. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. Characterized enzymes belonging to this subgroup include Lactobacillus brevis (LbAraf43) and Weissella sp (WAraf43) which show activity with similar catalytic efficiency on 1,5-alpha-L-arabinooligosaccharides with a degree of polymerization (DP) of 2-3; size is limited by an extended loop at the entrance to the active site. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG3940	COG3940	1.93e-39	383	707	9	317	Beta-xylosidase, GH43 family [Carbohydrate transport and metabolism].
pfam04616	Glyco_hydro_43	2.23e-34	386	684	9	274	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIH36934.1	4.54e-58	383	707	49	345
AWO00678.1	3.78e-57	344	654	19	317
AEV96439.1	6.02e-57	389	672	55	339
ANY76671.1	1.74e-56	389	653	44	292
QEH42441.1	1.87e-56	389	664	63	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M8B_A	3.83e-30	383	684	31	328	ChainA, Alpha-L-arabinofuranosidase II [Levilactobacillus brevis],5M8B_B Chain B, Alpha-L-arabinofuranosidase II [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82594	6.23e-27	383	654	54	318	Extracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999112	0.000157	0.000155	0.000140	0.000137

TMHMM  Annotations     

start	end
5	27