CAZyme Information: MGYG000004198_01329

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; UBA1191
• CAZyme ID: MGYG000004198_01329
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000004198_41|CGC1	40594.18	4.709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004198	1992745	MAG	United Kingdom	Europe

• Gene Location: Start: 13849; End: 14979 Strand: +

Full Sequence      

MKKKYLIAAIIILLLAACSVYAIRSFSSDRETDDSLSAPDSGQRADEIISKMTLEEKVGQ
MFMGCFYSYTPSVETVDEYHLGGVLLFRPSFTDTPRENLTARIAAIDGVCDIAPVTAVDE
EGGSVVRVSSSTYYRSEPFKSPQRLFAEGGMNAVISETHEKNRLLKSLGIDMNLAPVCDI
CTDPKNFMYSRSLAQDADTTADFAAKTVEACIEDEIACSLKHFPGYGSAADTHTGSAVDS
RSLEQLRNNDLIPFSAGIKAGAHSVLVSHNIVSSIDSSLPASLSPEVHKLLRNELDFDGV
VITDDLVMGAVTNYGSKAEIAILAVQAGNDLLCTGDYSVQIPAVISAVNDGIISEKRIDR
SVKRILMMKLRLGVIS

Enzyme Prediction     

No EC number prediction in MGYG000004198_01329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	333	1.4e-43	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	6.59e-65	53	366	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.29e-49	52	373	1	316	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.08e-33	82	333	27	280	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.11e-18	169	373	150	357	beta-glucosidase BglX.
PLN03080	PLN03080	2.81e-05	253	374	249	368	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02560.1	1.43e-113	43	376	87	419
BCI61427.1	5.48e-105	27	375	137	482
QHQ63470.1	1.71e-104	44	376	84	415
BCJ98858.1	1.71e-103	31	376	119	458
BCT44094.1	5.86e-103	46	376	126	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	5.98e-42	52	374	11	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.05e-36	19	374	11	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.30e-35	45	374	9	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.78e-35	45	374	39	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	3.28e-33	54	369	9	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.67e-35	19	374	11	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
B2FPW9	1.97e-30	81	332	24	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
B4SRK3	2.73e-30	81	332	24	275	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
Q9PAZ0	1.81e-27	73	332	16	275	Beta-hexosaminidase OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=nagZ PE=3 SV=1
Q82SJ8	4.29e-27	81	332	28	280	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.131450	0.071993	0.795164	0.000338	0.000277	0.000772

TMHMM  Annotations     

start	end
5	23