CAZyme Information: MGYG000004193_00669

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1810; UMGS1810; NSJ-50
• CAZyme ID: MGYG000004193_00669
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		31086.6	6.4584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004193	2272810	MAG	United Kingdom	Europe

• Gene Location: Start: 6297; End: 7169 Strand: +

Full Sequence      

MCKNIKIKDITAKNSPCWTIHPMCCENVEISSVTVLNPYSSPNTDGINPESCKNVMISNC
HIDVGDDCVTIKSGTEDDTLQKQRPCENITVTNCTMSHGHGGVVIGSEMSGGVKNVVISN
CVFQNTDRGIRIKSRRNRGGCVDGIIVGNIIMDRVKCAVTVNEFYWCGAPKGSGHLFDEK
SMPVTHLTPKISNISINGIIAKNVEAAGIYMCGLPECNISDITINNADITVTGCKEGFEA
VLAYNRPLSFGDGIVMENVKDVCMNGVKISGGNGVAVKNCTNVTFNGENL

Enzyme Prediction     

No EC number prediction in MGYG000004193_00669.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	2	236	1.1e-64	0.6307692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.54e-56	2	277	246	523	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.10e-25	2	156	93	240	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	3.65e-22	2	165	146	301	Probable polygalacturonase At3g15720
PLN02218	PLN02218	4.35e-20	3	165	201	355	polygalacturonase ADPG
PLN03010	PLN03010	4.32e-19	2	165	165	320	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APC39525.1	1.90e-92	2	270	145	411
QIK73183.1	1.21e-90	2	271	137	404
QJX64444.1	4.61e-89	2	269	140	405
AYV68537.1	4.61e-89	2	269	140	405
QFK71207.1	1.03e-88	2	270	145	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.41e-35	2	266	198	433	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	5.61e-25	2	150	208	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	5.08e-16	3	165	160	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	3.24e-13	3	203	340	536	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	6.20e-52	2	216	30	247	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	6.51e-37	4	229	209	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q9LW07	5.33e-23	2	227	146	360	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q8RY29	5.95e-20	3	233	201	424	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2
Q9SFB7	1.56e-19	2	235	201	424	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004193_00669.