CAZyme Information: MGYG000004192_00941

Basic Information

• Species: CAG-793 sp900557475
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-793; CAG-793 sp900557475
• CAZyme ID: MGYG000004192_00941
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000004192_56|CGC1	26652.79	7.1641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004192	1409933	MAG	United Kingdom	Europe

• Gene Location: Start: 4198; End: 4902 Strand: -

Full Sequence      

MKKIIGKILIIFLILLASIGLFVVGSGYDMYKKAVEKVPIETQVKKIEAKENYTELEEMP
QIYKDAVISVEDHRFYEHNGIDIIAIARAIFNDIRTLSFAEGGSTITQQLAKNIYFTQEK
KITRKIAEVFAAFYIEDKLEKNQILELYLNTSYFGDGYDTVKEASKGYFNKEPINLNDSE
ATMLAGIPNAPSVYAPTQNLKLAKQRQKQVLEQMCKYGKLKEEDANRILETGNK

Enzyme Prediction     

No EC number prediction in MGYG000004192_00941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	46	214	1.1e-60	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.22e-67	53	214	15	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.91e-62	53	231	4	182	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.76e-55	47	227	72	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.02e-50	53	226	69	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.17e-35	54	231	61	237	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM09777.1	1.03e-83	6	229	18	241
QRP41835.1	8.90e-81	11	233	13	235
ASN93505.1	8.90e-81	11	233	13	235
QJU22158.1	8.90e-81	11	233	13	235
QIX92252.1	1.46e-79	11	233	13	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.25e-35	53	218	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	4.93e-35	53	218	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	5.32e-32	43	194	49	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	5.93e-32	43	194	13	170	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	6.08e-32	43	194	14	171	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	2.76e-38	48	230	65	247	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O87579	1.78e-37	48	214	65	231	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P38050	6.97e-37	56	225	72	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q5FAC7	1.15e-36	48	214	65	231	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z6	1.15e-36	48	214	65	231	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.877153	0.112908	0.006840	0.000516	0.000289	0.002308

TMHMM  Annotations     

start	end
5	27