CAZyme Information: MGYG000004175_01148

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA5026
• CAZyme ID: MGYG000004175_01148
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959		106651.44	8.9012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004175	1240794	MAG	United Kingdom	Europe

• Gene Location: Start: 4409; End: 7288 Strand: -

Full Sequence      

MKEFINKNKDYIIIGTVSLIAFIIGCLAINFWVSLIIIGLADIILFIPNLMKNRKKVEKG
RHAALNKKKAKPKKVKAEKKEKKKKKIWKKLLFIFLILCIFAILAFCAFWAYIVANAPKF
KPEELYHQEASTLFDKDGKEFAKLGAENREIISYDDLPEVLIDAIVATEDSRFYQHNGVD
LPRFAKATIQTLLGGSNAGGASTLTMQLVKNHYTSTQRSLTRKFTDIYMAVYEVEKKYTK
EEILEFYVNAPYLGGGSYGVEQACKTYFGKSAKDINLAEAALIAGLFQSPGGDDPTRHPE
KAEKRRQIVLKLMERHGYITKEEKEAASKLTVDKLLVKKDNDNTSDKNEYQGFIDTVVEE
LNDDGIDPYKTAYNIYTTMDRDKQNHINDIMNGKTWDWKDDKVTAGIAVVDVNNGELVAI
GAGRNKNSERTLNTATQLKKQIGSTAKPIFDYSVGIEYENWSTYEPFSDENITYSDGTSL
SNWDGSYMGYLTLRNALAQSRNTSAVKAFKKNKNENIKEVVTKLGLHPDETLHQAHAIGG
YGGENVVTMAAAYATFANNGEYNSPHSYTKVVNKNNNEETKKQVTTNKVFSPQTSYIMTD
LLKSSAKVGLGGYSNINGATYGAKTGTSNFSDKDKKNLKLPNSAIADYWVSGTSPDYAIS
VWYGYEVPNKEYHNSFGTSYHERLFQKVGKGIFKKNSTFKNPGGVSSVSVENETYPAKLP
SEYTPKGLIVTELFKTGTEPTEKSERFSKLANVTNLSSSVSGNELTLSWKAIDTPYALKE
DKIKDLAKDLFETSGFQNRFISSRNSYNNNNIGSVVYKIYGKKDDGSLELLDTTSNASIT
LTVNSSSPTKYVVKTSYTIFTANMSDGVETSVSLNGVTDNIELKLIGDENITTPKGTYEE
EGIKVIINSEETTEKASSITYTSVAGTPSSLEMMNSTPGSYTVTYSYNGKTITRNVTIQ

Enzyme Prediction     

No EC number prediction in MGYG000004175_01148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	137	314	9.6e-61	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	9.53e-145	91	744	17	652	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.37e-103	91	744	8	768	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	9.76e-79	137	314	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	4.38e-69	98	664	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	2.39e-58	156	664	40	516	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG61477.1	1.31e-147	111	773	58	719
QED48401.1	6.43e-146	111	773	54	718
QPA32949.1	5.63e-144	111	770	55	723
AYA76804.1	1.64e-143	111	841	57	759
AKO91601.1	2.05e-143	111	751	58	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.35e-88	133	706	10	603	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.28e-86	117	706	3	612	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.83e-56	233	673	2	440	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.42e-52	233	673	2	440	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3NB6_A	7.24e-42	135	327	6	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	3.33e-127	111	780	57	739	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	4.47e-85	112	665	34	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	1.87e-81	112	665	34	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	6.81e-81	112	665	34	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.55e-70	123	733	41	641	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995993	0.001140	0.002211	0.000009	0.000004	0.000658

TMHMM  Annotations     

start	end
12	29
33	50
91	113