CAZyme Information: MGYG000004172_01495

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_01495
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000004172_5|CGC5	48518.74	8.3773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 234551; End: 235825 Strand: +

Full Sequence      

MKKISIWAAALLLGTTALAAPKSDEPYSRRMARSQGREWTHGKPWDYVNGLVAKSMLMMC
EQYGDAPWTQEYYDLAKAYADDAINEDGTFKNFRKGNIDNINAGKVLFELYRHESRLDRK
NGTDHAARYRKAADFLRDYLKNDYSRIQLPAAEGCFFHKDIYPNQMWLDGLYMGAAFYAE
WQKNFAPDDMESWSDIARQFIVVNERTYDPEYGLNYHGWSADPSDPNSFWAKREAPFKGC
SQEFWGRGMGWYFAALVDVLEVMPKNHPDYRKLVGITEQVARGLRRWQDRKSGVWYQLLR
YDDTFKGECGLPNYLESSASGMFAYAYLKGVRIGVLGSEYLPTAEKAYKGVLKTFITRNP
DGTINVESSCRSAGLGPARDPHRDGTASYYLCGKDVTRVNNEGKAIGPFIMASLEYEKLK
NRSK

Enzyme Prediction     

No EC number prediction in MGYG000004172_01495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	38	418	5.7e-103	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.14e-83	27	420	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.62e-81	24	419	12	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37243.1	9.40e-220	3	420	2	416
QRQ48843.1	2.35e-141	1	420	1	449
QUT45332.1	4.71e-141	1	420	1	449
BBE19946.1	1.92e-94	45	416	58	393
QCK16975.1	4.28e-87	45	417	23	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.49e-79	25	419	2	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.11e-56	20	419	9	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.24e-55	45	419	29	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	9.14e-17	138	421	175	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	4.05e-14	199	364	197	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.16e-55	20	419	9	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.76e-22	173	415	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.76e-22	173	415	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	3.47e-10	167	393	201	399	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999120	0.000151	0.000151	0.000146	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_01495.